Recombinant Full Length Rat H-2 Class Ii Histocompatibility Antigen Gamma Chain(Cd74) Protein, His-Tagged
| Cat.No. : | RFL12540RF |
| Product Overview : | Recombinant Full Length Rat H-2 class II histocompatibility antigen gamma chain(Cd74) Protein (P10247) (1-280aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Rat |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | Full Length (1-280) |
| Form : | Lyophilized powder |
| AA Sequence : | MDDQRDLISNHEQLPILGQRARAPESNCNRGVLYTSVSVLVALLLAGQATTAYFLYQQQGRLDKLTVTSQNLQLENLRMKLPKSAKPVSPMRMATPLLMRPLSMDNMLQAPVKNVTKYGNMTQDHVMHLLTKSGPVNYPQLKGSFPENLKHLKNSMNGLDWKVFESWMKQWLLFEMSKNSLEEKQPTQTPPKVLTKCQEEVSHIPDVHPGAFRPKCDENGNYMPLQCHGSTGYCWCVFPNGTEVPHTKSRGRHNCSEPLDMEDPSSGLGVTKQDMGQMFL |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Applications : | SDS-PAGE |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Gene Name | Cd74 |
| Synonyms | Cd74; H-2 class II histocompatibility antigen gamma chain; Ia antigen-associated invariant chain; Ii; MHC class II-associated invariant chain; CD antigen CD74) [Cleaved into: Class-II-associated invariant chain peptide; CLIP)] |
| UniProt ID | P10247 |
| ◆ Recombinant Proteins | ||
| CD74-151H | Recombinant Human CD74 Protein, DYKDDDDK-tagged | +Inquiry |
| CD74-5369H | Recombinant Human CD74 Protein (Gln73-Met296), N-His tagged | +Inquiry |
| CD74-1262R | Recombinant Rat CD74 Protein | +Inquiry |
| CD74-589H | Recombinant Human CD74 molecule, major histocompatibility complex, class II invariant chain, His-tagged | +Inquiry |
| Cd74-1157M | Recombinant Mouse Cd74 Protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CD74-2603HCL | Recombinant Human CD74 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Cd74 Products
Required fields are marked with *
My Review for All Cd74 Products
Required fields are marked with *



