Recombinant Full Length Rat H-2 Class Ii Histocompatibility Antigen Gamma Chain(Cd74) Protein, His-Tagged
Cat.No. : | RFL12540RF |
Product Overview : | Recombinant Full Length Rat H-2 class II histocompatibility antigen gamma chain(Cd74) Protein (P10247) (1-280aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-280) |
Form : | Lyophilized powder |
AA Sequence : | MDDQRDLISNHEQLPILGQRARAPESNCNRGVLYTSVSVLVALLLAGQATTAYFLYQQQGRLDKLTVTSQNLQLENLRMKLPKSAKPVSPMRMATPLLMRPLSMDNMLQAPVKNVTKYGNMTQDHVMHLLTKSGPVNYPQLKGSFPENLKHLKNSMNGLDWKVFESWMKQWLLFEMSKNSLEEKQPTQTPPKVLTKCQEEVSHIPDVHPGAFRPKCDENGNYMPLQCHGSTGYCWCVFPNGTEVPHTKSRGRHNCSEPLDMEDPSSGLGVTKQDMGQMFL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Cd74 |
Synonyms | Cd74; H-2 class II histocompatibility antigen gamma chain; Ia antigen-associated invariant chain; Ii; MHC class II-associated invariant chain; CD antigen CD74) [Cleaved into: Class-II-associated invariant chain peptide; CLIP)] |
UniProt ID | P10247 |
◆ Recombinant Proteins | ||
RFL21480HF | Recombinant Full Length Human Hla Class Ii Histocompatibility Antigen Gamma Chain(Cd74) Protein, His-Tagged | +Inquiry |
CD74-1262R | Recombinant Rat CD74 Protein | +Inquiry |
Cd74-6871M | Recombinant Mouse Cd74 protein, His & T7-tagged | +Inquiry |
CD74-114H | Recombinant Human CD74, His-tagged | +Inquiry |
CD74-546H | Active Recombinant Human CD74 Protein, HA-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CD74-2603HCL | Recombinant Human CD74 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Cd74 Products
Required fields are marked with *
My Review for All Cd74 Products
Required fields are marked with *
0
Inquiry Basket