Recombinant Full Length Rat Interleukin-2 Receptor Subunit Alpha(Il2Ra) Protein, His-Tagged
Cat.No. : | RFL15962RF |
Product Overview : | Recombinant Full Length Rat Interleukin-2 receptor subunit alpha(Il2ra) Protein (P26897) (22-267aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length of Mature Protein (22-267) |
Form : | Lyophilized powder |
AA Sequence : | ELCLYDPPEVPNATFKALSYKNGTILNCECKRGFRRLNELVYMACLGNSWSNNCQCTSNSHDNSREQVTPQPEGQKEQQTTDTQKSTQSVYQENLAGHCREPPPWRHEDTKRIYHFVEGQIVLYTCIQGYKALQRGPAISICKTVCGEIRWTHPQLTCVDEKEHHQFLASEESQGSRNSFPESEASCPTPNTDFSQLTEATTTMETFVFTKEYQVAVASCIFLLLSILLLSGFTWQHRWRKSRRTI |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Il2ra |
Synonyms | Il2ra; Interleukin-2 receptor subunit alpha; IL-2 receptor subunit alpha; IL-2-RA; IL-2R subunit alpha; IL2-RA; CD antigen CD25 |
UniProt ID | P26897 |
◆ Recombinant Proteins | ||
IL2RA-135CF | Recombinant Cynomolgus IL2RA Protein, LEVLFQ-tagged, FITC conjugated | +Inquiry |
IL2RA-133CAF555 | Recombinant Monkey IL2RA Protein, Fc-tagged, Alexa Fluor 555 conjugated | +Inquiry |
IL2RA-247R | Recombinant Rhesus IL2RA protein, His & Avi-tagged, Biotinylated | +Inquiry |
IL2RA-134CAF555 | Recombinant Cynomolgus IL2RA Protein, His-tagged, Alexa Fluor 555 conjugated | +Inquiry |
Il2ra-474R | Active Recombinant Rat Interleukin 2 Receptor, Alpha | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL2RA-2907HCL | Recombinant Human IL2RA cell lysate | +Inquiry |
IL2RA-2024MCL | Recombinant Mouse IL2RA cell lysate | +Inquiry |
IL2RA-1015CCL | Recombinant Cynomolgus IL2RA cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Il2ra Products
Required fields are marked with *
My Review for All Il2ra Products
Required fields are marked with *