Recombinant Full Length Rat Leukocyte-Associated Immunoglobulin-Like Receptor 1(Lair1) Protein, His-Tagged
Cat.No. : | RFL4292RF |
Product Overview : | Recombinant Full Length Rat Leukocyte-associated immunoglobulin-like receptor 1(Lair1) Protein (P0C1X9) (22-263aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length of Mature Protein (22-263) |
Form : | Lyophilized powder |
AA Sequence : | QEESLSDFTICAEPGPVIPQGNFITIVCSTSGEYDTVRLEKEGSTFMEKKTEPHGKQHRF RIGPVNETITGYYNCIFEKNYVWSQRSNDLQLKVIKENVTQGLAPGPSMTSDTSWLKTYS IHILTVVSVIFLLCLSLFLFCFLSHRQKKQGLPNNKSQHQRSQERLNLATNGLEKTSDIV MDDSLSEDRQTETWTPVAGDLQEVTYAQLDHDSLTQRTVKDVTPQNRVIMAESSTYAAIM RC |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Lair1 |
Synonyms | Lair1; Leukocyte-associated immunoglobulin-like receptor 1; LAIR-1; rLAIR1; CD antigen CD305 |
UniProt ID | P0C1X9 |
◆ Recombinant Proteins | ||
LAIR1-170R | Recombinant Rhesus Macaque LAIR1(Gln22-Try165) Protein, C-6*His-tagged | +Inquiry |
LAIR1-4404H | Recombinant Human LAIR1 Protein (Gln22-His163), C-His tagged | +Inquiry |
LAIR1-524H | Recombinant Human LAIR1 Protein, His-tagged | +Inquiry |
LAIR1-524HB | Recombinant Human LAIR1 protein, His-tagged, Biotinylated | +Inquiry |
LAIR1-624H | Recombinant Human LAIR1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
LAIR1-1331MCL | Recombinant Mouse LAIR1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Lair1 Products
Required fields are marked with *
My Review for All Lair1 Products
Required fields are marked with *