Recombinant Full Length Rat Lysophosphatidic Acid Receptor 1(Lpar1) Protein, His-Tagged
Cat.No. : | RFL25122RF |
Product Overview : | Recombinant Full Length Rat Lysophosphatidic acid receptor 1(Lpar1) Protein (P61794) (1-364aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-364) |
Form : | Lyophilized powder |
AA Sequence : | MAAASTSSPVISQPQFTAMNEQQCFYNESIAFFYNRSGKYLATEWNTVSKLVMGLGITVC VFIMLANLLVMVAIYVNRRFHFPIYYLMANLAAADFFAGLAYFYLMFNTGPNTRRLTVST WLLRQGLIDTSLTASVANLLAIAIERHITVFRMQLHTRMSNRRVVVVIVVIWTMAIVMGA IPSVGWNCICDIDHCSNMAPLYSDSYLVFWAIFNLVTFVVMVVLYAHIFGYVRQRTMRMS RHSSGPRRNRDTMMSLLKTVVIVLGAFIVCWTPGLVLLLLDVCCPQCDVLAYEKFFLLLA EFNSAMNPIIYSYRDKEMSATFRQILCCQRNENPNGPTEGSDRSASSLNHTILAGVHSND HSVV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Lpar1 |
Synonyms | Lpar1; Edg2; Gpcr91; Lpa1; Lysophosphatidic acid receptor 1; LPA receptor 1; LPA-1; Lysophosphatidic acid receptor Edg-2 |
UniProt ID | P61794 |
◆ Recombinant Proteins | ||
LPAR1-490H | Recombinant Human LPAR1 protein, GST-tagged | +Inquiry |
LPAR1-1245Z | Recombinant Zebrafish LPAR1 | +Inquiry |
RFL5301OF | Recombinant Full Length Sheep Lysophosphatidic Acid Receptor 1(Lpar1) Protein, His-Tagged | +Inquiry |
LPAR1-660HF | Recombinant Full Length Human LPAR1 Protein, GST-tagged | +Inquiry |
LPAR1-5134M | Recombinant Mouse LPAR1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
LPAR1-4675HCL | Recombinant Human LPAR1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Lpar1 Products
Required fields are marked with *
My Review for All Lpar1 Products
Required fields are marked with *
0
Inquiry Basket