Recombinant Human LPAR1 protein, GST-tagged
Cat.No. : | LPAR1-490H |
Product Overview : | Recombinant Human LPAR1(1 a.a. - 364 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Protein Length : | 1-364 a.a. |
Description : | The integral membrane protein encoded by this gene is a lysophosphatidic acid (LPA) receptor from a group known as EDG receptors. These receptors are members of the G protein-coupled receptor superfamily. Utilized by LPA for cell signaling, EDG receptors mediate diverse biologic functions, including proliferation, platelet aggregation, smooth muscle contraction, inhibition of neuroblastoma cell differentiation, chemotaxis, and tumor cell invasion. Two transcript variants encoding the same protein have been identified for this gene |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 67.5 kDa |
AA Sequence : | MAAISTSIPVISQPQFTAMNEPQCFYNESIAFFYNRSGKHLATEWNTVSKLVMGLGITVCIFIMLANLLVMVAIY VNRRFHFPIYYLMANLAAADFFAGLAYFYLMFNTGPNTRRLTVSTWLLRQGLIDTSLTASVANLLAIAIERHITV FRMQLHTRMSNRRVVVVIVVIWTMAIVMGAIPSVGWNCICDIENCSNMAPLYSDSYLVFWAIFNLVTFVVMVVLY AHIFGYVRQRTMRMSRHSSGPRRNRDTMMSLLKTVVIVLGAFIICWTPGLVLLLLDVCCPQCDVLAYEKFFLLLA EFNSAMNPIIYSYRDKEMSATFRQILCCQRSENPTGPTEGSDRSASSLNHTILAGVHSNDHSVV |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Gene Name | LPAR1 lysophosphatidic acid receptor 1 [ Homo sapiens ] |
Official Symbol | LPAR1 |
Synonyms | LPAR1; lysophosphatidic acid receptor 1; EDG2, endothelial differentiation, lysophosphatidic acid G protein coupled receptor, 2; edg 2; Gpcr26; GPR26; LPA1; Mrec1.3; rec.1.3; vzg 1; LPA-1; LPA receptor 1; ventricular zone gene 1; lysophosphatidic acid receptor Edg-2; endothelial differentiation, lysophosphatidic acid G-protein-coupled receptor, 2; EDG2; VZG1; edg-2; vzg-1; |
Gene ID | 1902 |
mRNA Refseq | NM_001401 |
Protein Refseq | NP_001392 |
MIM | 602282 |
UniProt ID | Q92633 |
Chromosome Location | 9q |
Pathway | Class A/1 (Rhodopsin-like receptors), organism-specific biosystem; G alpha (i) signalling events, organism-specific biosystem; G alpha (q) signalling events, organism-specific biosystem; GPCR downstream signaling, organism-specific biosystem; GPCR ligand binding, organism-specific biosystem; Gap junction, organism-specific biosystem; Gap junction, conserved biosystem; |
Function | G-protein alpha-subunit binding; G-protein coupled receptor activity; PDZ domain binding; lysophosphatidic acid receptor activity; phospholipid binding; protein binding; receptor activity; signal transducer activity; |
◆ Cell & Tissue Lysates | ||
LPAR1-4675HCL | Recombinant Human LPAR1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LPAR1 Products
Required fields are marked with *
My Review for All LPAR1 Products
Required fields are marked with *