Recombinant Full Length Rat Matrix Metalloproteinase-16(Mmp16) Protein, His-Tagged
Cat.No. : | RFL7251RF |
Product Overview : | Recombinant Full Length Rat Matrix metalloproteinase-16(Mmp16) Protein (O35548) (120-607aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length of Mature Protein (120-607) |
Form : | Lyophilized powder |
AA Sequence : | YALTGQKWQHKHITYSIKNVTPKVGDPETRRAIRRAFDVWQNVTPLTFEEVPYSELENGKRDVDITIIFASGFHGDRSPFDGEGGFLAHAYFPGPGIGGDTHFDSDEPWTLGNPNHDGNDLFLVAVHELGHALGLEHSNDPTAIMAPFYQYMETDNFKLPNDDLQGIQKIYGPPDKIPPPTRPLPTVPPHRSVPPADPRKNDRPKPPRPPTGRPSYPGAKPNICDGNFNTLAILRREMFVFKDQWFWRVRNNRVMDGYPMQITYFWRGLPPSIDAVYENSDGNFVFFKGNKYWVFKDTTLQPGYPHDLITLGNGIPPHGIDSAIWWEDVGKTYFFKGDRYWRYSEEMKTMDPGYPKPITIWKGIPESPQGAFVHKENGFTYFYKGKEYWKFNNQILKVEPGYPRSILKDFMGCDGPTDRDKEGLSPPDDVDIVIKLDNTASTVKAIAIVIPCILALCLLVLVYTVFQFKRKGTPRHILYCKRSMQEWV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Mmp16 |
Synonyms | Mmp16; Matrix metalloproteinase-16; MMP-16; Membrane-type matrix metalloproteinase 3; MT-MMP 3; MTMMP3; Membrane-type-3 matrix metalloproteinase; MT3-MMP; MT3MMP |
UniProt ID | O35548 |
◆ Recombinant Proteins | ||
MMP16-6751C | Recombinant Chicken MMP16 | +Inquiry |
RFL25871HF | Recombinant Full Length Human Matrix Metalloproteinase-16(Mmp16) Protein, His-Tagged | +Inquiry |
MMP16-608H | Recombinant Human MMP16, Catalytic Domain | +Inquiry |
MMP16-3370R | Recombinant Rat MMP16 Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL7251RF | Recombinant Full Length Rat Matrix Metalloproteinase-16(Mmp16) Protein, His-Tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Mmp16 Products
Required fields are marked with *
My Review for All Mmp16 Products
Required fields are marked with *
0
Inquiry Basket