Recombinant Full Length Rat Mitochondrial Brown Fat Uncoupling Protein 1(Ucp1) Protein, His-Tagged
Cat.No. : | RFL9919RF |
Product Overview : | Recombinant Full Length Rat Mitochondrial brown fat uncoupling protein 1(Ucp1) Protein (P04633) (2-307aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length of Mature Protein (2-307) |
Form : | Lyophilized powder |
AA Sequence : | VSSTTSEVQPTMGVKIFSAGVSACLADIITFPLDTAKVRLQIQGEGQASSTIRYKGVLGT ITTLAKTEGLPKLYSGLPAGIQRQISFASLRIGLYDTVQEYFSSGRETPASLGSKISAGL MTGGVAVFIGQPTEVVKVRMQAQSHLHGIKPRYTGTYNAYRVIATTESLSTLWKGTTPNL MRNVIINCTELVTYDLMKGALVNHHILADDVPCHLLSALVAGFCTTLLASPVDVVKTRFI NSLPGQYPSVPSCAMTMYTKEGPAAFFKGFAPSFLRLGSWNVIMFVCFEQLKKELMKSRQ TVDCTT |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Ucp1 |
Synonyms | Ucp1; Slc25a7; Ucp; Mitochondrial brown fat uncoupling protein 1; UCP 1; Solute carrier family 25 member 7; Thermogenin |
UniProt ID | P04633 |
◆ Recombinant Proteins | ||
UCP1-2916H | Recombinant Human UCP1 protein, His-tagged | +Inquiry |
UCP1-9176H | Recombinant Human UCP1, His-tagged | +Inquiry |
RFL19243HF | Recombinant Full Length Human Mitochondrial Brown Fat Uncoupling Protein 1(Ucp1) Protein, His-Tagged | +Inquiry |
UCP1-6421R | Recombinant Rat UCP1 Protein | +Inquiry |
Ucp1-283R | Recombinant Rat Ucp1 Protein, His/GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
UCP1-526HCL | Recombinant Human UCP1 293 Cell Lysate, Flag-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Ucp1 Products
Required fields are marked with *
My Review for All Ucp1 Products
Required fields are marked with *