Recombinant Full Length Rat Neuropilin And Tolloid-Like Protein 2(Neto2) Protein, His-Tagged
Cat.No. : | RFL22284RF |
Product Overview : | Recombinant Full Length Rat Neuropilin and tolloid-like protein 2(Neto2) Protein (C6K2K4) (23-525aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length of Mature Protein (23-525) |
Form : | Lyophilized powder |
AA Sequence : | IAVAQKTQDGQNIGIKHVPATQCGIWVRTSNGGHFASPNYPDSYPPNKECIYILEAAPRQRIELTFDERYYIEPSFECRFDHLEVRDGPFGFSPLIDRYCGMKSPALIRSTGRFMWIKFSSDEELEGLGFRAKYSFIPDPDFTYLGGILNPIPDCQFELSGADGIVRSSQVEQEEKTKPGQAVDCIWTIKATPKAKIYLRFLDYQMEHSNECKRNFVAVYDGSSAIENLKAKFCSTVANDVMLKTGVGVIRMWADEGSRLSRFRMLFTSFVEPPCTSSTFFCHSNMCINNSLVCNGVQNCAYPWDENHCKEKKKAGLFEQITKTHGTIIGVTSGIVLVLLIISILVQVKQPRKKVMACKTAFNKTGFQEVFDPPHYELFSLREKEISADLADLSEELDNYQKLRRSSTASRCIHDHHCGSQASSVKQSRTNLSSMELPFRNDFAQPQPMKTFNSTFKKSSYTFKQTHDCPEQALEDRVMEEIPCEIYVRGRDDSAQASISIDF |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Neto2 |
Synonyms | Neto2; Btcl2; Neuropilin and tolloid-like protein 2; Brain-specific transmembrane protein containing 2 CUB and 1 LDL-receptor class A domains protein 2 |
UniProt ID | C6K2K4 |
◆ Recombinant Proteins | ||
NETO2-3004R | Recombinant Rhesus monkey NETO2 Protein, His-tagged | +Inquiry |
NETO2-2823R | Recombinant Rhesus Macaque NETO2 Protein, His (Fc)-Avi-tagged | +Inquiry |
NETO2-3618R | Recombinant Rat NETO2 Protein, His (Fc)-Avi-tagged | +Inquiry |
NETO2-3960R | Recombinant Rat NETO2 Protein | +Inquiry |
NETO2-1265H | Recombinant Human NETO2, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
NETO2-3872HCL | Recombinant Human NETO2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Neto2 Products
Required fields are marked with *
My Review for All Neto2 Products
Required fields are marked with *
0
Inquiry Basket