Recombinant Full Length Rat Ox-2 Membrane Glycoprotein(Cd200) Protein, His-Tagged
Cat.No. : | RFL6756RF |
Product Overview : | Recombinant Full Length Rat OX-2 membrane glycoprotein(Cd200) Protein (P04218) (31-278aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (31-278) |
Form : | Lyophilized powder |
AA Sequence : | QVEVVTQDERKLLHTTASLRCSLKTTQEPLIVTWQKKKAVGPENMVTYSKAHGVVIQPTYKDRINITELGLLNTSITFWNTTLDDEGCYMCLFNMFGSGKVSGTACLTLYVQPIVHLHYNYFEDHLNITCSATARPAPAISWKGTGSGIENSTESHSHSNGTTSVTSILRVKDPKTQVGKEVICQVLYLGNVIDYKQSLDKGFWFSVPLLLSIVSLVILLVLISILLYWKRHRNQERGESSQGMQRMK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Cd200 |
Synonyms | Cd200; Mox2; OX-2 membrane glycoprotein; MRC OX-2 antigen; CD antigen CD200 |
UniProt ID | P04218 |
◆ Recombinant Proteins | ||
CD200-2658H | Active Recombinant Human CD200 protein, His-tagged | +Inquiry |
CD200-2486C | Recombinant Chicken CD200 | +Inquiry |
CD200-218H | Recombinant Human CD200 Protein, DYKDDDDK-tagged | +Inquiry |
CD200-212H | Recombinant Human CD200 Protein, DYKDDDDK/His-tagged | +Inquiry |
CD200-0743H | Recombinant Human CD200 Protein, MYC/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CD200-2707HCL | Recombinant Human CD200 cell lysate | +Inquiry |
CD200-1041CCL | Recombinant Cynomolgus CD200 cell lysate | +Inquiry |
CD200-2638MCL | Recombinant Mouse CD200 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Cd200 Products
Required fields are marked with *
My Review for All Cd200 Products
Required fields are marked with *
0
Inquiry Basket