Recombinant Full Length Rat Phospholipid Scramblase 1(Plscr1) Protein, His-Tagged
Cat.No. : | RFL28163RF |
Product Overview : | Recombinant Full Length Rat Phospholipid scramblase 1(Plscr1) Protein (P58195) (1-335aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-335) |
Form : | Lyophilized powder |
AA Sequence : | MEKHGPPEHAAYPIPQADYQGSQGPYPGPQGPYPGPQGPYAGPQGPYPGPQGPYAGPQGPYPGPQPGYPVPPGSYAGGDPSGFPVQHQPAYNHPGGPGGTPWMQAPPPPLDCPPGLEYLTQIDQILVHQQIELLEVLTGFETNNKYEIKNSLGQRVYFAVEDTDCCTRNCCGASRPFTLRILDNMGREVMTLERPLRCSSCCFPCCLQEIEIQAPPGVPVGYVIQTWHPCLPKFTLQNEKRQDVLKVVGPCVVCSCCSDIDFELKSLDEESVVGKISKQWSGFVREAFTDADNFGIQFPLDLDVKMKAVMLGACFLIDFMFFERTGNEEQRSGVW |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Plscr1 |
Synonyms | Plscr1; Phospholipid scramblase 1; PL scramblase 1; Ca(2+-dependent phospholipid scramblase 1; Mg(2+-dependent nuclease |
UniProt ID | P58195 |
◆ Recombinant Proteins | ||
PLSCR1-1797H | Recombinant Human PLSCR1, GST-tagged | +Inquiry |
PLSCR1-4938H | Recombinant Human PLSCR1 Protein (Met1-Trp318), His tagged | +Inquiry |
RFL884HF | Recombinant Full Length Human Phospholipid Scramblase 1(Plscr1) Protein, His-Tagged | +Inquiry |
PLSCR1-3296R | Recombinant Rhesus Macaque PLSCR1 Protein, His (Fc)-Avi-tagged | +Inquiry |
PLSCR1-12989M | Recombinant Mouse PLSCR1 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
PLSCR1-3096HCL | Recombinant Human PLSCR1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Plscr1 Products
Required fields are marked with *
My Review for All Plscr1 Products
Required fields are marked with *
0
Inquiry Basket