Recombinant Full Length Rat Sodium/Potassium-Transporting Atpase Subunit Beta-1(Atp1B1) Protein, His-Tagged
Cat.No. : | RFL-15257RF |
Product Overview : | Recombinant Full Length Rat Sodium/potassium-transporting ATPase subunit beta-1(Atp1b1) Protein (P07340) (1-304aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-304) |
Form : | Lyophilized powder |
AA Sequence : | MARGKAKEEGSWKKFIWNSEKKEFLGRTGGSWFKILLFYVIFYGCLAGIFIGTIQVMLLTISELKPTYQDRVAPPGLTQIPQIQKTEISFRPNDPKSYEAYVLNIIRFLEKYKDSAQKDDMIFEDCGSMPSEPKERGEFNHERGERKVCRFKLDWLGNCSGLNDESYGYKEGKPCIIIKLNRVLGFKPKPPKNESLETYPLTMKYNPNVLPVQCTGKRDEDKDKVGNIEYFGMGGFYGFPLQYYPYYGKLLQPKYLQPLLAVQFTNLTLDTEIRIECKAYGENIGYSEKDRFQGRFDVKIEVKS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Atp1b1 |
Synonyms | Atp1b1; Sodium/potassium-transporting ATPase subunit beta-1; Sodium/potassium-dependent ATPase subunit beta-1 |
UniProt ID | P07340 |
◆ Recombinant Proteins | ||
ATP1B1-1131HF | Recombinant Full Length Human ATP1B1 Protein, GST-tagged | +Inquiry |
Atp1b1-462M | Recombinant Mouse Atp1b1 Protein, His-tagged | +Inquiry |
ATP1B1-449R | Recombinant Rhesus monkey ATP1B1 Protein, His-tagged | +Inquiry |
ATP1B1-512R | Recombinant Rat ATP1B1 Protein, His (Fc)-Avi-tagged | +Inquiry |
ATP1B1-278R | Recombinant Rhesus Macaque ATP1B1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ATP1B1-919HCL | Recombinant Human ATP1B1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Atp1b1 Products
Required fields are marked with *
My Review for All Atp1b1 Products
Required fields are marked with *