Recombinant Mouse Atp1b1 Full Length Transmembrane protein, His-tagged
Cat.No. : | Atp1b1-1309M |
Product Overview : | Recombinant Mouse Atp1b1 protein(P14094)(1-304aa), fused with N-terminal His tag, was expressed in in vitro E. coli expression system. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-304aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
AA Sequence : | MARGKAKEEGSWKKFIWNSEKKEFLGRTGGSWFKILLFYVIFYGCLAGIFIGTIQVMLLTISELKPTYQDRVAPPGLTQIPQIQKTEISFRPNDPKSYEAYVLNIIRFLEKYKDSAQKDDMIFEDCGNVPSEPKERGDINHERGERKVCRFKLDWLGNCSGLNDDSYGYREGKPCIIIKLNRVLGFKPKPPKNESLETYPLMMKYNPNVLPVQCTGKRDEDKDKVGNIEYFGMGGYYGFPLQYYPYYGKLLQPKYLQPLLAVQFTNLTVDTEIRVECKAYGENIGYSEKDRFQGRFDVKIEIKS- |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
Gene Name | Atp1b1 ATPase, Na+/K+ transporting, beta 1 polypeptide [ Mus musculus ] |
Official Symbol | Atp1b1 |
Synonyms | ATP1B1; ATPase, Na+/K+ transporting, beta 1 polypeptide; sodium/potassium-transporting ATPase subunit beta-1; sodium/potassium ATPase beta subunit; sodium/potassium-dependent ATPase subunit beta-1; Atpb; Atpb-1; |
Gene ID | 11931 |
mRNA Refseq | NM_009721 |
Protein Refseq | NP_033851 |
◆ Recombinant Proteins | ||
Atp1b1-1309M | Recombinant Mouse Atp1b1 Full Length Transmembrane protein, His-tagged | +Inquiry |
ATP1B1-850M | Recombinant Mouse ATP1B1 Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL-11841CF | Recombinant Full Length Dog Sodium/Potassium-Transporting Atpase Subunit Beta-1(Atp1B1) Protein, His-Tagged | +Inquiry |
ATP1B1-449R | Recombinant Rhesus monkey ATP1B1 Protein, His-tagged | +Inquiry |
ATP1B1-321C | Recombinant Cynomolgus ATP1B1 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ATP1B1-919HCL | Recombinant Human ATP1B1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Atp1b1 Products
Required fields are marked with *
My Review for All Atp1b1 Products
Required fields are marked with *