Recombinant Full Length Rat Tumor Necrosis Factor Receptor Superfamily Member 4(Tnfrsf4) Protein, His-Tagged
| Cat.No. : | RFL13373RF |
| Product Overview : | Recombinant Full Length Rat Tumor necrosis factor receptor superfamily member 4(Tnfrsf4) Protein (P15725) (20-271aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Rat |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | Full Length of Mature Protein (20-271) |
| Form : | Lyophilized powder |
| AA Sequence : | VTVKLNCVKDTYPSGHKCCRECQPGHGMVSRCDHTRDTVCHPCEPGFYNEAVNYDTCKQCTQCNHRSGSELKQNCTPTEDTVCQCRPGTQPRQDSSHKLGVDCVPCPPGHFSPGSNQACKPWTNCTLSGKQIRHPASNSLDTVCEDRSLLATLLWETQRTTFRPTTVPSTTVWPRTSQLPSTPTLVAPEGPAFAVILGLGLGLLAPLTVLLALYLLRKAWRSPNTPKPCWGNSFRTPIQEEQTDTHFTLAKI |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Applications : | SDS-PAGE |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Gene Name | Tnfrsf4 |
| Synonyms | Tnfrsf4; Ox40; Txgp1l; Tumor necrosis factor receptor superfamily member 4; MRC OX40; OX40 antigen; OX40L receptor; CD antigen CD134 |
| UniProt ID | P15725 |
| ◆ Recombinant Proteins | ||
| TNFRSF4-548RAF555 | Recombinant Monkey TNFRSF4 Protein, His-tagged, Alexa Fluor 555 conjugated | +Inquiry |
| TNFRSF4-340M | Active Recombinant Marmoset TNFRSF4 protein, His-tagged | +Inquiry |
| TNFRSF4-548RAF647 | Recombinant Monkey TNFRSF4 Protein, His-tagged, Alexa Fluor 647 conjugated | +Inquiry |
| TNFRSF4-1565R | Recombinant Rhesus Monkey TNFRSF4 Protein | +Inquiry |
| Tnfrsf4-547M | Recombinant Mouse Tnfrsf4 Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| TNFRSF4-2422HCL | Recombinant Human TNFRSF4 cell lysate | +Inquiry |
| TNFRSF4-1762MCL | Recombinant Mouse TNFRSF4 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Tnfrsf4 Products
Required fields are marked with *
My Review for All Tnfrsf4 Products
Required fields are marked with *
