Recombinant Mouse Tnfrsf4 protein, His-SUMO-tagged
Cat.No. : | Tnfrsf4-3602M |
Product Overview : | Recombinant Mouse Tnfrsf4 protein(P47741)(20-211aa), fused to N-terminal His-SUMO tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 20-211aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 37.3 kDa |
AA Sequence : | VTARRLNCVKHTYPSGHKCCRECQPGHGMVSRCDHTRDTLCHPCETGFYNEAVNYDTCKQCTQCNHRSGSELKQNCTPTQDTVCRCRPGTQPRQDSGYKLGVDCVPCPPGHFSPGNNQACKPWTNCTLSGKQTRHPASDSLDAVCEDRSLLATLLWETQRPTFRPTTVQSTTVWPRTSELPSPPTLVTPEGP |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | Tnfrsf4 tumor necrosis factor receptor superfamily, member 4 [ Mus musculus ] |
Official Symbol | Tnfrsf4 |
Synonyms | TNFRSF4; tumor necrosis factor receptor superfamily, member 4; tumor necrosis factor receptor superfamily member 4; OX40 antigen; OX40L receptor; tax-transcriptionally activated glycoprotein 1; Ox40; ACT35; CD134; Ly-70; Txgp1; TXGP1L; |
Gene ID | 22163 |
mRNA Refseq | NM_011659 |
Protein Refseq | NP_035789 |
◆ Recombinant Proteins | ||
TNFRSF4-05H | Active Recombinant Human TNFRSF4 Protein, hIgG/His-tagged | +Inquiry |
TNFRSF4-682M | Recombinant Mouse TNFRSF4 Protein | +Inquiry |
TNFRSF4-1153H | Recombinant Human TNFRSF4 Protein (Met1-Ala216), HlgG1 Fc-tagged | +Inquiry |
TNFRSF4-3247HAF488 | Recombinant Human TNFRSF4 Protein, His-tagged, Alexa Fluor 488 conjugated | +Inquiry |
Tnfrsf4-547MF | Recombinant Mouse Tnfrsf4 Protein, FITC conjugated | +Inquiry |
◆ Cell & Tissue Lysates | ||
TNFRSF4-2422HCL | Recombinant Human TNFRSF4 cell lysate | +Inquiry |
TNFRSF4-1762MCL | Recombinant Mouse TNFRSF4 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Tnfrsf4 Products
Required fields are marked with *
My Review for All Tnfrsf4 Products
Required fields are marked with *