Recombinant Mouse Tnfrsf4 protein, His-SUMO-tagged
| Cat.No. : | Tnfrsf4-3602M |
| Product Overview : | Recombinant Mouse Tnfrsf4 protein(P47741)(20-211aa), fused to N-terminal His-SUMO tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse |
| Source : | E.coli |
| Tag : | His&SUMO |
| Protein Length : | 20-211aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 37.3 kDa |
| AA Sequence : | VTARRLNCVKHTYPSGHKCCRECQPGHGMVSRCDHTRDTLCHPCETGFYNEAVNYDTCKQCTQCNHRSGSELKQNCTPTQDTVCRCRPGTQPRQDSGYKLGVDCVPCPPGHFSPGNNQACKPWTNCTLSGKQTRHPASDSLDAVCEDRSLLATLLWETQRPTFRPTTVQSTTVWPRTSELPSPPTLVTPEGP |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | Tnfrsf4 tumor necrosis factor receptor superfamily, member 4 [ Mus musculus ] |
| Official Symbol | Tnfrsf4 |
| Synonyms | TNFRSF4; tumor necrosis factor receptor superfamily, member 4; tumor necrosis factor receptor superfamily member 4; OX40 antigen; OX40L receptor; tax-transcriptionally activated glycoprotein 1; Ox40; ACT35; CD134; Ly-70; Txgp1; TXGP1L; |
| Gene ID | 22163 |
| mRNA Refseq | NM_011659 |
| Protein Refseq | NP_035789 |
| ◆ Cell & Tissue Lysates | ||
| TNFRSF4-1762MCL | Recombinant Mouse TNFRSF4 cell lysate | +Inquiry |
| TNFRSF4-2422HCL | Recombinant Human TNFRSF4 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Tnfrsf4 Products
Required fields are marked with *
My Review for All Tnfrsf4 Products
Required fields are marked with *
