Recombinant Full Length Rat Udp-Glucuronosyltransferase 1-6(Ugt1) Protein, His-Tagged
Cat.No. : | RFL32553RF |
Product Overview : | Recombinant Full Length Rat UDP-glucuronosyltransferase 1-6(Ugt1) Protein (P08430) (26-529aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length of Mature Protein (26-529) |
Form : | Lyophilized powder |
AA Sequence : | DKLLVVPQDGSHWLSMKEIVEHLSERGHDIVVLVPEVNLLLGESKYYRRKSFPVPYNLEE LRTRYRSFGNNHFAASSPLMAPLREYRNNMIVIDMCFFSCQSLLKDSATLSFLRENQFDA LFTDPAMPCGVILAEYLKLPSIYLFRGFPCSLEHIGQSPSPVSYVPRFYTKFSDHMTFPQ RLANFIANILENYLYHCLYSKYEILASDLLKRDVSLPALHQNSLWLLRYDFVFEYPRPVM PNMIFIGGTNCKKKGNLSQEFEAYVNASGEHGIVVFSLGSMVSEIPEKKAMEIAEALGRI PQTLLWRYTGTRPSNLAKNTILVKWLPQNDLLGHPKARAFITHSGSHGIYEGICNGVPMV MMPLFGDQMDNAKRMETRGAGVTLNVLEMTADDLENALKTVINNKSYKENIMRLSSLHKD RPIEPLDLAVFWVEYVMRHKGAPHLRPAAHDLTWYQYHSLDVIGFLLAIVLTVVFIVYKS CAYGCRKCFGGKGRVKKSHKSKTH |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Ugt1a6 |
Synonyms | Ugt1a6; Ugt1; UDP-glucuronosyltransferase 1-6; UDPGT 1-6; UGT1*6; UGT1-06; UGT1.6; A1; P-nitrophenol-specific UDPGT; UDP-glucuronosyltransferase 1A6; UGT1A6 |
UniProt ID | P08430 |
◆ Recombinant Proteins | ||
UGT1A6-96H | Recombinant Human UGT1A6 Protein | +Inquiry |
UGT1A6-31663TH | Recombinant Human UGT1A6 | +Inquiry |
UGT1A6-7719Z | Recombinant Zebrafish UGT1A6 | +Inquiry |
UGT1A6-6088R | Recombinant Rat UGT1A6 Protein, His (Fc)-Avi-tagged | +Inquiry |
UGT1A6-208H | Recombinant Human UGT1A6, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
UGT1A6-511HCL | Recombinant Human UGT1A6 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Ugt1a6 Products
Required fields are marked with *
My Review for All Ugt1a6 Products
Required fields are marked with *
0
Inquiry Basket