Recombinant Full Length Rat Udp-Glucuronosyltransferase 2B17(Ugt2B17) Protein, His-Tagged
Cat.No. : | RFL30827RF |
Product Overview : | Recombinant Full Length Rat UDP-glucuronosyltransferase 2B17(Ugt2b17) Protein (P08542) (24-530aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length of Mature Protein (24-530) |
Form : | Lyophilized powder |
AA Sequence : | GKVLVWPMEFSHWMNIKTILDELVQRGHEVTVLKPSAYYVLDPKKSPDLKFETFPTSVSK DELENYFIKLVDVWTYELQRDTCLSYSPLLQNMIDGFSDYYLSLCKDTVSNKQLMAKLQE SKFDVLLSDPVAACGELIAEVLHIPFLYSLRFSPGYKIEKSSGRFILPPSYVPVILSGMG GPMTFIDRVKNMICTLYFDFWFHMFNAKKWDPFYSEILGRPTTLAETMGKAEMWLIRSYW DLEFPHPTLPNVDYIGGLQCRPPKPLPKDMEDFVQSSGEHGVVVFSLGSMVSSMTEEKAN AIAWALAQIPQKVLWKFDGKTPATLGPNTRVYKWLPQNDLLGHPKTKAFVTHSGANGVYE AIYHGIPMVGIPMFGEQHDNIAHMVAKGAAVTLNIRTMSKSDLFNALKEIINNPFYKKNA VWLSTIHHDQPMKPLDKAVFWIEFVMRHKGAKHLRPLGHDLPWYQYHSLDVIGFLLTCSA VIAVLTVKCFLFIYRLFVKKEKKMKNE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Ugt2b17 |
Synonyms | Ugt2b17; Ugt2b3; Ugt2b5; UDP-glucuronosyltransferase 2B17; UDPGT 2B17; UGT2B17; 17-beta-hydroxysteroid-specific UDPGT; RLUG38; Testosterone, dihydrotestosterone, and beta-estradiol-specific UDPGT; UDP-glucuronosyltransferase 2B5; UDPGT 2B5; UDPGTr-3 |
UniProt ID | P08542 |
◆ Recombinant Proteins | ||
UGT2B17-6091R | Recombinant Rat UGT2B17 Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL30827RF | Recombinant Full Length Rat Udp-Glucuronosyltransferase 2B17(Ugt2B17) Protein, His-Tagged | +Inquiry |
UGT2B17-173H | Recombinant Human UGT2B17 Full Length Transmembrane protein, His-tagged | +Inquiry |
RFL17799MF | Recombinant Full Length Mouse Udp-Glucuronosyltransferase 2B17(Ugt2B17) Protein, His-Tagged | +Inquiry |
UGT2B17-6435R | Recombinant Rat UGT2B17 Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Ugt2b17 Products
Required fields are marked with *
My Review for All Ugt2b17 Products
Required fields are marked with *
0
Inquiry Basket