Recombinant Human UGT2B17 Full Length Transmembrane protein, His-tagged
Cat.No. : | UGT2B17-173H |
Product Overview : | Recombinant Human UGT2B17 protein(O75795)(24-530aa), fused with N-terminal His tag, was expressed in in vitro E. coli expression system. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 24-530aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 64.5 kDa |
AA Sequence : | GKVLVWPTEYSHWINMKTILEELVQRGHEVIVLTSSASILVNASKSSAIKLEVYPTSLTKNDLEDFFMKMFDRWTYSISKNTFWSYFSQLQELCWEYSDYNIKLCEDAVLNKKLMRKLQESKFDVLLADAVNPCGELLAELLNIPFLYSLRFSVGYTVEKNGGGFLFPPSYVPVVMSELSDQMIFMERIKNMIYMLYFDFWFQAYDLKKWDQFYSEVLGRPTTLFETMGKAEMWLIRTYWDFEFPRPFLPNVDFVGGLHCKPAKPLPKEMEEFVQSSGENGIVVFSLGSMISNMSEESANMIASALAQIPQKVLWRFDGKKPNTLGSNTRLYKWLPQNDLLGHPKTKAFITHGGTNGIYEAIYHGIPMVGIPLFADQHDNIAHMKAKGAALSVDIRTMSSRDLLNALKSVINDPIYKENIMKLSRIHHDQPVKPLDRAVFWIEFVMRHKGAKHLRVAAHNLTWIQYHSLDVIAFLLACVATMIFMITKCCLFCFRKLAKTGKKKKRD |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
Gene Name | UGT2B17 UDP glucuronosyltransferase 2 family, polypeptide B17 [ Homo sapiens ] |
Official Symbol | UGT2B17 |
Synonyms | UGT2B17; UDP glucuronosyltransferase 2 family, polypeptide B17; UDP glycosyltransferase 2 family, polypeptide B17; UDP-glucuronosyltransferase 2B17; C19-steroid-specific UDPGT; UDP glycosyltransferase 2 family, member B17; UDP-glucuronyltransferase, family 2, beta-17; C19-steroid-specific UDP-glucuronosyltransferase; UDPGT2B17; |
Gene ID | 7367 |
mRNA Refseq | NM_001077 |
Protein Refseq | NP_001068 |
MIM | 601903 |
UniProt ID | O75795 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All UGT2B17 Products
Required fields are marked with *
My Review for All UGT2B17 Products
Required fields are marked with *
0
Inquiry Basket