Recombinant Human UGT2B17 Full Length Transmembrane protein, His-tagged
| Cat.No. : | UGT2B17-173H |
| Product Overview : | Recombinant Human UGT2B17 protein(O75795)(24-530aa), fused with N-terminal His tag, was expressed in in vitro E. coli expression system. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 24-530aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 64.5 kDa |
| AA Sequence : | GKVLVWPTEYSHWINMKTILEELVQRGHEVIVLTSSASILVNASKSSAIKLEVYPTSLTKNDLEDFFMKMFDRWTYSISKNTFWSYFSQLQELCWEYSDYNIKLCEDAVLNKKLMRKLQESKFDVLLADAVNPCGELLAELLNIPFLYSLRFSVGYTVEKNGGGFLFPPSYVPVVMSELSDQMIFMERIKNMIYMLYFDFWFQAYDLKKWDQFYSEVLGRPTTLFETMGKAEMWLIRTYWDFEFPRPFLPNVDFVGGLHCKPAKPLPKEMEEFVQSSGENGIVVFSLGSMISNMSEESANMIASALAQIPQKVLWRFDGKKPNTLGSNTRLYKWLPQNDLLGHPKTKAFITHGGTNGIYEAIYHGIPMVGIPLFADQHDNIAHMKAKGAALSVDIRTMSSRDLLNALKSVINDPIYKENIMKLSRIHHDQPVKPLDRAVFWIEFVMRHKGAKHLRVAAHNLTWIQYHSLDVIAFLLACVATMIFMITKCCLFCFRKLAKTGKKKKRD |
| Purity : | Greater than 85% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
| Gene Name | UGT2B17 UDP glucuronosyltransferase 2 family, polypeptide B17 [ Homo sapiens ] |
| Official Symbol | UGT2B17 |
| Synonyms | UGT2B17; UDP glucuronosyltransferase 2 family, polypeptide B17; UDP glycosyltransferase 2 family, polypeptide B17; UDP-glucuronosyltransferase 2B17; C19-steroid-specific UDPGT; UDP glycosyltransferase 2 family, member B17; UDP-glucuronyltransferase, family 2, beta-17; C19-steroid-specific UDP-glucuronosyltransferase; UDPGT2B17; |
| Gene ID | 7367 |
| mRNA Refseq | NM_001077 |
| Protein Refseq | NP_001068 |
| MIM | 601903 |
| UniProt ID | O75795 |
| ◆ Recombinant Proteins | ||
| UGT2B17-6091R | Recombinant Rat UGT2B17 Protein, His (Fc)-Avi-tagged | +Inquiry |
| UGT2B17-6435R | Recombinant Rat UGT2B17 Protein | +Inquiry |
| RFL17799MF | Recombinant Full Length Mouse Udp-Glucuronosyltransferase 2B17(Ugt2B17) Protein, His-Tagged | +Inquiry |
| RFL30827RF | Recombinant Full Length Rat Udp-Glucuronosyltransferase 2B17(Ugt2B17) Protein, His-Tagged | +Inquiry |
| UGT2B17-173H | Recombinant Human UGT2B17 Full Length Transmembrane protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All UGT2B17 Products
Required fields are marked with *
My Review for All UGT2B17 Products
Required fields are marked with *



