Recombinant Human UGT2B17 Full Length Transmembrane protein, His-tagged

Cat.No. : UGT2B17-173H
Product Overview : Recombinant Human UGT2B17 protein(O75795)(24-530aa), fused with N-terminal His tag, was expressed in in vitro E. coli expression system.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 24-530aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 64.5 kDa
AA Sequence : GKVLVWPTEYSHWINMKTILEELVQRGHEVIVLTSSASILVNASKSSAIKLEVYPTSLTKNDLEDFFMKMFDRWTYSISKNTFWSYFSQLQELCWEYSDYNIKLCEDAVLNKKLMRKLQESKFDVLLADAVNPCGELLAELLNIPFLYSLRFSVGYTVEKNGGGFLFPPSYVPVVMSELSDQMIFMERIKNMIYMLYFDFWFQAYDLKKWDQFYSEVLGRPTTLFETMGKAEMWLIRTYWDFEFPRPFLPNVDFVGGLHCKPAKPLPKEMEEFVQSSGENGIVVFSLGSMISNMSEESANMIASALAQIPQKVLWRFDGKKPNTLGSNTRLYKWLPQNDLLGHPKTKAFITHGGTNGIYEAIYHGIPMVGIPLFADQHDNIAHMKAKGAALSVDIRTMSSRDLLNALKSVINDPIYKENIMKLSRIHHDQPVKPLDRAVFWIEFVMRHKGAKHLRVAAHNLTWIQYHSLDVIAFLLACVATMIFMITKCCLFCFRKLAKTGKKKKRD
Purity : Greater than 85% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
Gene Name UGT2B17 UDP glucuronosyltransferase 2 family, polypeptide B17 [ Homo sapiens ]
Official Symbol UGT2B17
Synonyms UGT2B17; UDP glucuronosyltransferase 2 family, polypeptide B17; UDP glycosyltransferase 2 family, polypeptide B17; UDP-glucuronosyltransferase 2B17; C19-steroid-specific UDPGT; UDP glycosyltransferase 2 family, member B17; UDP-glucuronyltransferase, family 2, beta-17; C19-steroid-specific UDP-glucuronosyltransferase; UDPGT2B17;
Gene ID 7367
mRNA Refseq NM_001077
Protein Refseq NP_001068
MIM 601903
UniProt ID O75795

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All UGT2B17 Products

Required fields are marked with *

My Review for All UGT2B17 Products

Required fields are marked with *

0
cart-icon