Recombinant Full Length Rat Zinc Transporter Zip11(Slc39A11) Protein, His-Tagged
Cat.No. : | RFL22774RF |
Product Overview : | Recombinant Full Length Rat Zinc transporter ZIP11(Slc39a11) Protein (Q6P6S2) (1-335aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-335) |
Form : | Lyophilized powder |
AA Sequence : | MLQGYSSVSQALLGTFFTWAMTAAGAALVFIFSSGQRRILDGSLGFAAGVMLAASYWSLL APAVEMATSSGGFGAFAFFPVAVGFTLGAAFVYLADLLMPHLGAGEDPQTALALNLDPAL VKKSDLKDPASLLFPERELSIRIDKRENGEVYQRKKLAATDFPEGAAPSGPVHGNSGQPG VSSWRRIALLILAITIHNIPEGLAVGVGFGAVEKTASATFESARNLAIGIGIQNFPEGLA VSLPLRGAGFSTWKAFWYGQLSGMVEPLAGVFGAFAVVLAEPVLPYALAFAAGAMVYVVM DDIIPEAQISGNGKLASWASILGFVVMMSLDVGLG |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Slc39a11 |
Synonyms | Slc39a11; Zip11; Zinc transporter ZIP11; Solute carrier family 39 member 11; Zrt- and Irt-like protein 11; ZIP-11 |
UniProt ID | Q6P6S2 |
◆ Recombinant Proteins | ||
RFL6306BF | Recombinant Full Length Bovine Zinc Transporter Zip11(Slc39A11) Protein, His-Tagged | +Inquiry |
SLC39A11-15431M | Recombinant Mouse SLC39A11 Protein | +Inquiry |
RFL9657XF | Recombinant Full Length Xenopus Tropicalis Zinc Transporter Zip11(Slc39A11) Protein, His-Tagged | +Inquiry |
SLC39A11-2762H | Recombinant Human SLC39A11, His-tagged | +Inquiry |
RFL29547MF | Recombinant Full Length Mouse Zinc Transporter Zip11(Slc39A11) Protein, His-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SLC39A11-1724HCL | Recombinant Human SLC39A11 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Slc39a11 Products
Required fields are marked with *
My Review for All Slc39a11 Products
Required fields are marked with *