Recombinant Full Length Saccharomyces Cerevisiae Cytochrome Oxidase Assembly Protein 1(Coa1) Protein, His-Tagged
Cat.No. : | RFL23611SF |
Product Overview : | Recombinant Full Length Saccharomyces cerevisiae Cytochrome oxidase assembly protein 1(COA1) Protein (P40452) (1-197aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | S.cerevisiae |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-197) |
Form : | Lyophilized powder |
AA Sequence : | MMLRLVTKGLPKVTPSAAKAVLVRGSLLHSFSTSARFNNSVAEDEAKIVLKDKNRPLRID RELPDPTTERRKRIAGFLLFSVAIGSALSLIFNYEKTESPIISNTLYYIRRSPATKNILG ESIEFDGIIPWVYGELNSVKGRINITFYIKGDKNVTGTVRLVADRNTHDEEFLIHEWSVT AAGQKIDLLAENTKTPI |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | COA1 |
Synonyms | COA1; FMP35; YIL157C; Cytochrome c oxidase assembly factor 1 |
UniProt ID | P40452 |
◆ Recombinant Proteins | ||
COA1-4847HF | Recombinant Full Length Human COA1 Protein, GST-tagged | +Inquiry |
COA1-954R | Recombinant Rhesus monkey COA1 Protein, His-tagged | +Inquiry |
COA1-1252H | Recombinant Human COA1 | +Inquiry |
COA1-2708H | Recombinant Human COA1 Protein, His (Fc)-Avi-tagged | +Inquiry |
COA1-4224H | Recombinant Human COA1 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
COA1-628HCL | Recombinant Human COA1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All COA1 Products
Required fields are marked with *
My Review for All COA1 Products
Required fields are marked with *
0
Inquiry Basket