Recombinant Human COA1 Protein, GST-tagged

• Cat.No.: COA1-4224H
• Product Overview: Human FLJ10803 full-length ORF ( AAH56884, 1 a.a. - 146 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: COA1 (Cytochrome C Oxidase Assembly Factor 1 Homolog) is a Protein Coding gene.
• Molecular Mass: 41.8 kDa
• AA Sequence: MMWQKYAGSRRSMPLGARILFHGVFYAGGFAIVYYLIQKFHSRALYYKLAVEQLQSHPEAQEALGPPLNIHYLKLIDRENFVDIVDAKLKIPVSGSKSKGLLYVHSSRGGPFQRWHLDEVFLELKDGQQIPVFKLSGENGDEVKKE
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: COA1 cytochrome c oxidase assembly factor 1 homolog [ Homo sapiens (human) ]
• Official Symbol: COA1
• Synonyms: C7ORF44; chromosome 7 open reading frame 44; uncharacterized protein C7orf44; FLJ10803; COA1; cytochrome c oxidase assembly factor 1 homolog
• Gene ID: 55744
• mRNA Refseq: NM_018224
• Protein Refseq: NP_060694
• MIM: 614769
• UniProt ID: Q9GZY4