Recombinant Full Length Human COA1 Protein, GST-tagged
Cat.No. : | COA1-4847HF |
Product Overview : | Human FLJ10803 full-length ORF ( AAH56884, 1 a.a. - 146 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 146 amino acids |
Description : | COA1 (Cytochrome C Oxidase Assembly Factor 1 Homolog) is a Protein Coding gene. |
Molecular Mass : | 41.8 kDa |
AA Sequence : | MMWQKYAGSRRSMPLGARILFHGVFYAGGFAIVYYLIQKFHSRALYYKLAVEQLQSHPEAQEALGPPLNIHYLKLIDRENFVDIVDAKLKIPVSGSKSKGLLYVHSSRGGPFQRWHLDEVFLELKDGQQIPVFKLSGENGDEVKKE |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | COA1 cytochrome c oxidase assembly factor 1 homolog [ Homo sapiens (human) ] |
Official Symbol | COA1 |
Synonyms | C7ORF44; chromosome 7 open reading frame 44; uncharacterized protein C7orf44; FLJ10803; COA1; cytochrome c oxidase assembly factor 1 homolog |
Gene ID | 55744 |
mRNA Refseq | NM_018224 |
Protein Refseq | NP_060694 |
MIM | 614769 |
UniProt ID | Q9GZY4 |
◆ Recombinant Proteins | ||
RFL23611SF | Recombinant Full Length Saccharomyces Cerevisiae Cytochrome Oxidase Assembly Protein 1(Coa1) Protein, His-Tagged | +Inquiry |
COA1-371H | Recombinant Human COA1 Protein (38-146 aa), GST-tagged | +Inquiry |
COA1-4224H | Recombinant Human COA1 Protein, GST-tagged | +Inquiry |
COA1-2708H | Recombinant Human COA1 Protein, His (Fc)-Avi-tagged | +Inquiry |
COA1-1252H | Recombinant Human COA1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
COA1-628HCL | Recombinant Human COA1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All COA1 Products
Required fields are marked with *
My Review for All COA1 Products
Required fields are marked with *
0
Inquiry Basket