Recombinant Full Length Saccharomyces Cerevisiae Dolichol-Phosphate Mannosyltransferase(Dpm1) Protein, His-Tagged
Cat.No. : | RFL29232SF |
Product Overview : | Recombinant Full Length Saccharomyces cerevisiae Dolichol-phosphate mannosyltransferase(DPM1) Protein (P14020) (2-267aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | S.cerevisiae |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length of Mature Protein (2-267) |
Form : | Lyophilized powder |
AA Sequence : | SIEYSVIVPAYHEKLNIKPLTTRLFAGMSPEMAKKTELIFVDDNSQDGSVEEVDALAHQGYNVRIIVRTNERGLSSAVLKGFYEAKGQYLVCMDADLQHPPETVPKLFESLHDHAFTLGTRYAPGVGIDKDWPMYRRVISSTARMMARPLTIASDPMSGFFGLQKKYLENCNPRDINSQGFKIALELLAKLPLPRDPRVAIGEVPFTFGVRTEGESKLSGKVIIQYLQQLKELYVFKFGANNLILFITFWSILFFYVCYQLYHLVF |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | DPM1 |
Synonyms | DPM1; SED3; YPR183W; P9705.3; Dolichol-phosphate mannosyltransferase; Dolichol-phosphate mannose synthase; DPM synthase; Dolichyl-phosphate beta-D-mannosyltransferase; Mannose-P-dolichol synthase; MPD synthase |
UniProt ID | P14020 |
◆ Recombinant Proteins | ||
DPM1-01H | Recombinant Human DPM1 Protein, His-Tagged | +Inquiry |
DPM1-1023Z | Recombinant Zebrafish DPM1 | +Inquiry |
RFL7397UF | Recombinant Full Length Ustilago Maydis Dolichol-Phosphate Mannosyltransferase(Dpm1) Protein, His-Tagged | +Inquiry |
DPM1-2836H | Recombinant Human DPM1 Protein, GST-tagged | +Inquiry |
DPM1-315H | Recombinant Human DPM1 Protein, His/ABP-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
DPM1-6835HCL | Recombinant Human DPM1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DPM1 Products
Required fields are marked with *
My Review for All DPM1 Products
Required fields are marked with *