Recombinant Human DPM1 Protein, His/ABP-tagged

Cat.No. : DPM1-315H
Product Overview : Recombinant human DPM1 protein with a N-terminal His6/ABP-tag was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : ABP&His
Description : Dolichol-phosphate mannose (Dol-P-Man) serves as a donor of mannosyl residues on the lumenal side of the endoplasmic reticulum (ER). Lack of Dol-P-Man results in defective surface expression of GPI-anchored proteins. Dol-P-Man is synthesized from GDP-mannose and dolichol-phosphate on the cytosolic side of the ER by the enzyme dolichyl-phosphate mannosyltransferase. Human DPM1 lacks a carboxy-terminal transmembrane domain and signal sequence and is regulated by DPM2. Mutations in this gene are associated with congenital disorder of glycosylation type Ie. Alternative splicing results in multiple transcript variants.
Molecular Mass : 27 kDa
AA Sequence : SLEVSRSPRRSRRELEVRSPRQNKYSVLLPTYNERENLPLIVWLLVKSFSESGINYEIIIIDDGSPDGTRDVAEQLEKIYGSD
Purity : > 80% by SDS-PAGE and Coomassie blue staining
Applications : Antibody Competition
Notes : This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Storage : Store at -20 centigrade. Avoid freeze-thaw cycles.
Storage Buffer : PBS and 1M Urea, pH 7.4
Dilutions : Antibody Competition 10 - 100 molar excess
Gene Name DPM1 dolichyl-phosphate mannosyltransferase subunit 1, catalytic [ Homo sapiens (human) ]
Official Symbol DPM1
Synonyms DPM1; dolichyl-phosphate mannosyltransferase subunit 1, catalytic; MPDS; CDGIE; dolichol-phosphate mannosyltransferase subunit 1; DPM synthase complex, catalytic subunit; DPM synthase subunit 1; MPD synthase subunit 1; dolichol monophosphate mannose synthase; dolichol-phosphate mannose synthase subunit 1; dolichyl-phosphate beta-D-mannosyltransferase subunit 1; dolichyl-phosphate mannosyltransferase polypeptide 1 catalytic subunit; mannose-P-dolichol synthase subunit 1
Gene ID 8813
mRNA Refseq NM_001317034
Protein Refseq NP_001303963
MIM 603503
UniProt ID O60762

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All DPM1 Products

Required fields are marked with *

My Review for All DPM1 Products

Required fields are marked with *

0
cart-icon