Species : |
Human |
Source : |
E.coli |
Tag : |
ABP&His |
Description : |
Dolichol-phosphate mannose (Dol-P-Man) serves as a donor of mannosyl residues on the lumenal side of the endoplasmic reticulum (ER). Lack of Dol-P-Man results in defective surface expression of GPI-anchored proteins. Dol-P-Man is synthesized from GDP-mannose and dolichol-phosphate on the cytosolic side of the ER by the enzyme dolichyl-phosphate mannosyltransferase. Human DPM1 lacks a carboxy-terminal transmembrane domain and signal sequence and is regulated by DPM2. Mutations in this gene are associated with congenital disorder of glycosylation type Ie. Alternative splicing results in multiple transcript variants. |
Molecular Mass : |
27 kDa |
AA Sequence : |
SLEVSRSPRRSRRELEVRSPRQNKYSVLLPTYNERENLPLIVWLLVKSFSESGINYEIIIIDDGSPDGTRDVAEQLEKIYGSD |
Purity : |
> 80% by SDS-PAGE and Coomassie blue staining |
Applications : |
Antibody Competition |
Notes : |
This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions. |
Storage : |
Store at -20 centigrade. Avoid freeze-thaw cycles. |
Storage Buffer : |
PBS and 1M Urea, pH 7.4 |
Dilutions : |
Antibody Competition 10 - 100 molar excess |