Recombinant Full Length Sheep T-Cell Surface Glycoprotein Cd3 Delta Chain(Cd3D) Protein, His-Tagged
Cat.No. : | RFL34411OF |
Product Overview : | Recombinant Full Length Sheep T-cell surface glycoprotein CD3 delta chain(CD3D) Protein (P18438) (22-167aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Sheep |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length of Mature Protein (22-167) |
Form : | Lyophilized powder |
AA Sequence : | RALEVLEAEDKVILKCNSSITLLQGTAGQEVSDNKTLNLGKRIEDPRGMYQCGENAKSFTLQVYYRMCQNCVELDSATLAGLIITDIIATVLLALGVYCFAGHETGRFSRAADTQVLMGNDQLYQPLRERNDAQYSRLGDKWARNK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | CD3D |
Synonyms | CD3D; T-cell surface glycoprotein CD3 delta chain; T-cell receptor T3 delta chain; CD antigen CD3d |
UniProt ID | P18438 |
◆ Recombinant Proteins | ||
CD3D-908R | Recombinant Rat CD3D Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL11357RF | Recombinant Full Length Rat T-Cell Surface Glycoprotein Cd3 Delta Chain(Cd3D) Protein, His-Tagged | +Inquiry |
CD3D-5283H | Recombinant Human CD3D Protein (Met1-Ala105), C-His tagged | +Inquiry |
CD3D-0800H | Recombinant Human CD3D Protein, GST-Tagged | +Inquiry |
CD3D-10951H | Recombinant Human CD3D, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CD3D-1381MCL | Recombinant Mouse CD3D cell lysate | +Inquiry |
CD3D-1466CCL | Recombinant Cynomolgus CD3D cell lysate | +Inquiry |
CD3D-1274HCL | Recombinant Human CD3D cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CD3D Products
Required fields are marked with *
My Review for All CD3D Products
Required fields are marked with *