Recombinant Full Length Trichosurus Vulpecula Cd302 Antigen(Cd302) Protein, His-Tagged
Cat.No. : | RFL25448TF |
Product Overview : | Recombinant Full Length Trichosurus vulpecula CD302 antigen(CD302) Protein (A8WH72) (22-231aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Trichosurus vulpecula (Brush-tailed possum) |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length of Mature Protein (22-231) |
Form : | Lyophilized powder |
AA Sequence : | DCPSSSWVQFQSNCYIFLQTTVKIENIEDVRNQCTDSASGADMISIHNEEENAFILETFKKRWKAQDDILLGMFYDTDDESFKWYDKSNMTFNKWKNSEESQDLIDTCGFLQPKSGIWKKGNCEVSSVEGALCKAAVSYEKKYLPDHHILITALVIASTTILTITGAVVWFLYKRNLTSGLTNTAYTTAPQLPYNDDCILVDAEENEYVA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | CD302 |
Synonyms | CD302; CD302 antigen; Type I transmembrane C-type lectin receptor DCL-1 |
UniProt ID | A8WH72 |
◆ Recombinant Proteins | ||
CD302-1457M | Recombinant Mouse CD302 Protein, His (Fc)-Avi-tagged | +Inquiry |
CD302-3211H | Recombinant Human CD302 protein, His-tagged | +Inquiry |
Cd302-8803R | Recombinant Rat Cd302 protein(Met1-His165), hFc-tagged | +Inquiry |
RFL5232BF | Recombinant Full Length Bovine Cd302 Antigen(Cd302) Protein, His-Tagged | +Inquiry |
CD302-1246R | Recombinant Rat CD302 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
CD302-1747MCL | Recombinant Mouse CD302 cell lysate | +Inquiry |
CD302-1172RCL | Recombinant Rat CD302 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CD302 Products
Required fields are marked with *
My Review for All CD302 Products
Required fields are marked with *
0
Inquiry Basket