Recombinant Full Length Xenopus Laevis Frizzled-1(Fzd1) Protein, His-Tagged
Cat.No. : | RFL36410XF |
Product Overview : | Recombinant Full Length Xenopus laevis Frizzled-1(fzd1) Protein (Q9I9M5) (36-559aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Xenopus laevis |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length of Mature Protein (36-559) |
Form : | Lyophilized powder |
AA Sequence : | QYNGEKGISIPDHGYCQPISIPLCTDIAYNQTIMPNLLGHTNQEDAGLEVHQFYPLVKVQ CSPELKFFLCSIYAPVCTVLEQALPPCRSLCDRARQGCEALMNKFGFQWPESLRCEKFPI NGAGELCVGQNTTESGTPTPAVPETWTSNSRTYYRDKFMCPRALKVPAYVNYHFLGEKDC GAPCEVGKVHGLMYFAPEELNFARIWIGIWSVLCCASTLFTVLTYLVDMKRFSYPERPII FLSGCYTMVAIAYIAGFLLEDKVVCNERFAEDGYKTVAQGTKKEGCTFLFMMLYFFSMAS SIWWVILSLTWFLAAGMKWGHEAIEANSQYFHLAAWAVPAIKTITILAVGQVDGDTLSGV CFVGINNVDALRGFVLAPLFVYLFIGTSFLLAGFVSLFRIRTIMKHDGTKTEKLEKLMVR IGIFSVLYTVPATIVIACYFYEQAFREQWEKSWISQSCKTYAIPCPSTGHPPMSPDFTVF MIKYLMTLIVGITSGFWIWSGKTLNSWRKFYTRLTNSKQGETTV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | fzd1 |
Synonyms | fzd1; fz1; Frizzled-1; Fz-1; Xfz1 |
UniProt ID | Q9I9M5 |
◆ Recombinant Proteins | ||
RFL36410XF | Recombinant Full Length Xenopus Laevis Frizzled-1(Fzd1) Protein, His-Tagged | +Inquiry |
Fzd1-5672M | Recombinant Mouse Fzd1 Protein (Val69-His248), C-Fc tagged | +Inquiry |
RFL21067MF | Recombinant Full Length Mouse Frizzled-1(Fzd1) Protein, His-Tagged | +Inquiry |
FZD1-3201H | Recombinant Human FZD1 Protein (Gln117-Trp322), N-His tagged | +Inquiry |
FZD1-1238H | Recombinant Human FZD1 protein, His & T7-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FZD1-2633MCL | Recombinant Mouse FZD1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All fzd1 Products
Required fields are marked with *
My Review for All fzd1 Products
Required fields are marked with *
0
Inquiry Basket