Recombinant Full Length Xenopus Laevis Myelin Protein Zero-Like Protein 3(Mpzl3) Protein, His-Tagged
Cat.No. : | RFL3286XF |
Product Overview : | Recombinant Full Length Xenopus laevis Myelin protein zero-like protein 3(mpzl3) Protein (Q8AVM3) (17-229aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Xenopus laevis |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length of Mature Protein (17-229) |
Form : | Lyophilized powder |
AA Sequence : | IDISMHPDAFGVVGKSIKLKCSFTSSYPISDIVAVDWTYRQLNGGSTVTILHFQNKPYPI LEGPFKDRIIWEGDVRRGDASISLTDLRLTDNGTLSCIVWNPPDVHGNVPQTKLTVTIEN LFFQFNTVILLSALVFIPSALVSLLLLIRMRRSINRGRTKNLKWRKKSPIEESQDCVYDD NENTPLHPTLPQEQSPGCFMKFCLRCLDDSDED |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | mpzl3 |
Synonyms | mpzl3; Myelin protein zero-like protein 3 |
UniProt ID | Q8AVM3 |
◆ Recombinant Proteins | ||
MPZL3-12385Z | Recombinant Zebrafish MPZL3 | +Inquiry |
MPZL3-10007M | Recombinant Mouse MPZL3 Protein | +Inquiry |
MPZL3-4567C | Recombinant Chicken MPZL3 | +Inquiry |
MPZL3-6340HF | Recombinant Full Length Human MPZL3 Protein, GST-tagged | +Inquiry |
MPZL3-5528H | Recombinant Human MPZL3 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MPZL3-4216HCL | Recombinant Human MPZL3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All mpzl3 Products
Required fields are marked with *
My Review for All mpzl3 Products
Required fields are marked with *
0
Inquiry Basket