Recombinant Full Length Human MPZL3 Protein, GST-tagged

• Cat.No.: MPZL3-6340HF
• Product Overview: Human MPZL3 full-length ORF ( NP_938016.1, 1 a.a. - 235 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 235 amino acids
• Description: MPZL3 (Myelin Protein Zero Like 3) is a Protein Coding gene. An important paralog of this gene is MPZ.
• Molecular Mass: 52.4 kDa
• AA Sequence: MQQRGAAGSRGCALFPLLGVLFFQGVYIVFSLEIRADAHVRGYVGEKIKLKCTFKSTSDVTDKLTIDWTYRPPSSSHTVSIFHYQSFQYPTTAGTFRDRISWVGNVYKGDASISISNPTIKDNGTFSCAVKNPPDVHHNIPMTELTVTERGFGTMLSSVALLSILVFVPSAVVVALLLVRMGRKAAGLKKRSRSGYKKSSIEVSDDTDQEEEEACMARLCVRCAECLDSDYEETY
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: MPZL3 myelin protein zero-like 3 [ Homo sapiens ]
• Official Symbol: MPZL3
• Synonyms: MPZL3; myelin protein zero-like 3; myelin protein zero-like protein 3
• Gene ID: 196264
• mRNA Refseq: NM_198275
• Protein Refseq: NP_938016
• MIM: 611707
• UniProt ID: Q6UWV2