Recombinant Full Length Xenopus Laevis Proteinase-Activated Receptor 1(F2R) Protein, His-Tagged
Cat.No. : | RFL6189XF |
Product Overview : | Recombinant Full Length Xenopus laevis Proteinase-activated receptor 1(f2r) Protein (P47749) (43-420aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Xenopus laevis |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length of Mature Protein (43-420) |
Form : | Lyophilized powder |
AA Sequence : | TFRIFDDSESEFEEIPWDELDESGEGSGDQAPVSRSARKPIRRNITKEAEQYLSSQWLTK FVPSLYTVVFIVGLPLNLLAIIIFLFKMKVRKPAVVYMLNLAIADVFFVSVLPFKIAYHL SGNDWLFGPGMCRIVTAIFYCNMYCSVLLIASISVDRFLAVVYPMHSLSWRTMSRAYMAC SFIWLISIASTIPLLVTEQTQKIPRLDITTCHDVLDLKDLKDFYIYYFSSFCLLFFFVPF IITTICYIGIIRSLSSSSIENSCKKTRALFLAVVVLCVFIICFGPTNVLFLTHYLQEANE FLYFAYILSACVGSVSCCLDPLIYYYASSQCQRYLYSLLCCRKVSEPGSSTGQLMSTAMK NDNCSTNAKSSIYKKLLA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | f2r |
Synonyms | f2r; Proteinase-activated receptor 1; PAR-1; Thrombin receptor |
UniProt ID | P47749 |
◆ Recombinant Proteins | ||
F2R-2730H | Recombinant Human F2R protein, His-tagged | +Inquiry |
F2R-42H | Recombinant Human F2R Full length protein, Flag&Strep-tagged | +Inquiry |
RFL17197BF | Recombinant Full Length Bovine Proteinase-Activated Receptor 1(F2R) Protein, His-Tagged | +Inquiry |
F2r-2176R | Recombinant Rat F2r Protein, His-tagged | +Inquiry |
F2R-375H | Recombinant Human F2R | +Inquiry |
◆ Native Proteins | ||
F2R-27H | Native Human F2R Protein | +Inquiry |
RFL16109HF | Recombinant Full Length Human Proteinase-Activated Receptor 1(F2R) Protein, His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
F2R-2116HCL | Recombinant Human F2R cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All f2r Products
Required fields are marked with *
My Review for All f2r Products
Required fields are marked with *
0
Inquiry Basket