Recombinant Goat IFNG protein, His&Myc-tagged
Cat.No. : | IFNG-4318G |
Product Overview : | Recombinant Goat IFNG protein(P79154)(24-166aa), fused to N-terminal His tag and C-terminal Myc tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Goat |
Source : | E.coli |
Tag : | His&Myc |
Protein Length : | 24-166aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 27.7 kDa |
AA Sequence : | QGPFFKEIENLKEYFNASNPDVAKGGPLFSEILKNWKEESDKKIIQSQIVSFYFKLFENLKDNQVIQRSMDIIKQDMFQKFLNGSSEKLEDFKKLIQIPVDDLQIQRKAINELIKVMNDLSPKSNLRKRKRSQNLFRGRRASM |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
Gene Name | IFNG interferon-gamma [ Capra hircus ] |
Official Symbol | IFNG |
Synonyms | IFNG; interferon-gamma; IFN-gamma; |
Gene ID | 100860815 |
◆ Recombinant Proteins | ||
IFNG-632G | Recombinant Golden hamster IFNG protein, His&Strep II-tagged | +Inquiry |
IFNG-7654H | Recombinant Human IFNG protein, His-tagged | +Inquiry |
IFNG-5744C | Recombinant Cynomolgus monkey IFNG protein, His-tagged | +Inquiry |
IFNG-8157B | Recombinant Bovine IFNG protein, His-tagged | +Inquiry |
Ifng-078M | Active Recombinant Mouse Ifng Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
IFNG-1007FCL | Recombinant Ferret IFNG cell lysate | +Inquiry |
IFNG-001HCL | Recombinant Human IFNG cell lysate | +Inquiry |
IFNG-1797MCL | Recombinant Mouse IFNG cell lysate | +Inquiry |
IFNG-1536RCL | Recombinant Rat IFNG cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IFNG Products
Required fields are marked with *
My Review for All IFNG Products
Required fields are marked with *