Recombinant Guinea Pig CD46 Protein (36-316 aa), His-tagged

• Cat.No.: CD46-2331G
• Product Overview: Recombinant Guinea Pig (Cavia porcellus) CD46 Protein (36-316 aa) is produced by E. coli expression system. This protein is fused with a 6xHis tag at the N-terminal. Protein Description: Partial.

Specification

• Species: Guinea Pig
• Source: E.coli
• Tag: His
• Protein Length: 36-316 aa
• Description: May be involved in the fusion of the spermatozoa with the oocyte during fertilization.
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 35.4 kDa
• AA Sequence: CVLPPPFEAMEPINPKPYYEIGEKVEYRCKKGYLRQPFYLMVATCEKNHSWVPITDDGCIKKQCTYLNPPPKGRVEYINGTRTWGDIVHFSCVEGFYVSGIAALSCELRGDNVDWNGRVPTCEKVLCSPPPKIQNGKYTFSDVQVFEYFEAVTYSCDAVQGPDKLSLVGNEVLYCAGHQKWSSAAPECKVVKCPLPVVKNGKQISGLGQTFFYQATVTFQCLPGFYFNGSSTVVCGSDNTWKPSIPECLKGPKPTHPTKPPVYNYPGYPNPREGIFDQELN
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA will be sent along with the products. Please refer to it for detailed information.

Gene Information

• Gene Name: Cd46 CD46 antigen, complement regulatory protein [ Cavia porcellus ]
• Official Symbol: CD46
• Synonyms: CD46; membrane cofactor protein; membrane cofactor protein(GMP1-full); MCP
• Gene ID: 100135498
• mRNA Refseq: NM_001172928
• Protein Refseq: NP_001166399
• UniProt ID: P70105