Recombinant Guinea Pig CD46 Protein (36-316 aa), His-tagged

Cat.No. : CD46-2331G
Product Overview : Recombinant Guinea Pig (Cavia porcellus) CD46 Protein (36-316 aa) is produced by E. coli expression system. This protein is fused with a 6xHis tag at the N-terminal. Protein Description: Partial.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Guinea Pig
Source : E.coli
Tag : His
Protein Length : 36-316 aa
Description : May be involved in the fusion of the spermatozoa with the oocyte during fertilization.
Form : Tris-based buffer,50% glycerol
Molecular Mass : 35.4 kDa
AA Sequence : CVLPPPFEAMEPINPKPYYEIGEKVEYRCKKGYLRQPFYLMVATCEKNHSWVPITDDGCIKKQCTYLNPPPKGRVEYINGTRTWGDIVHFSCVEGFYVSGIAALSCELRGDNVDWNGRVPTCEKVLCSPPPKIQNGKYTFSDVQVFEYFEAVTYSCDAVQGPDKLSLVGNEVLYCAGHQKWSSAAPECKVVKCPLPVVKNGKQISGLGQTFFYQATVTFQCLPGFYFNGSSTVVCGSDNTWKPSIPECLKGPKPTHPTKPPVYNYPGYPNPREGIFDQELN
Purity : > 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA will be sent along with the products. Please refer to it for detailed information.
Gene Name Cd46 CD46 antigen, complement regulatory protein [ Cavia porcellus ]
Official Symbol CD46
Synonyms CD46; membrane cofactor protein; membrane cofactor protein(GMP1-full); MCP;
Gene ID 100135498
mRNA Refseq NM_001172928
Protein Refseq NP_001166399
UniProt ID P70105

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CD46 Products

Required fields are marked with *

My Review for All CD46 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon