Recombinant Hamster Prnp Protein
Cat.No. : | Prnp-191H |
Product Overview : | Recombinant Hamster Prnp(23-231 aa) was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Hamster |
Source : | E.coli |
Tag : | Non |
Protein Length : | 23-231 aa |
Description : | Prion Protein (PrP) is an abundant cellular protein in mammalian neural tissue. It is associated with mammalian prion diseases, e.g. transmissible spongiforme encephalophathies that include human Creutzfeld-Jakob disease, bovine spongiforme encephalopathy, sheep scrapie, cervid’s chronic wasting disease and various rodent prion diseases. In the disease process, PrP undergoes protein aggregation into disease specific PrPSc. |
Form : | Finally dialysed in pure water, shock frozen in liquid nitrogen at a protein concentration of 0.25 mg/ml |
Molecular Mass : | 23117 kg/mol |
AA Sequence : | GSKKRPKPGGGWNTGGSRYPGQGSPGGNRYPPQGGGGWGQPHGGGWGQPHGGGWGQPHGGGWGQPHGGGWGQPHGGGGWGQGGTHGQWNKPSKPKTNMKHVAGAAAAGAVVGGLGGYMLGSAMSRP LIHFGSDYEDRYYRENMHRYPNQVYYRPVDQYSNQNNFVHDCVNITVKEHTVTTTTKGENFTETDIKMMERVVEQMCITQYQRESQAYYQRGA |
Purity : | > 95% by SDS-PAGE |
Applications : | Prion Protein is frequently used in analytical aggregation assays |
Notes : | Thawing: Gentle agitation at 37 centigrade until no ice is left. Keep on ice. Do not refreeze |
Storage : | Store at -80 centigrade |
Concentration : | 0.25 mg/ml |
Gene Name | Prnp prion protein [ Mesocricetus auratus ] |
Official Symbol | Prnp |
Synonyms | PRP; PrP27-30; PrP33-35C; Major prion protein; PrP 27-30 |
Gene ID | 101829062 |
UniProt ID | P04273 |
◆ Recombinant Proteins | ||
PRNP-742R | Recombinant Rat PRNP Protein (29-231 aa), His-tagged | +Inquiry |
Prnp-791M | Recombinant Mouse Prion Protein, His-tagged | +Inquiry |
Prnp-797O | Recombinant Ovine Prion Protein, His-tagged | +Inquiry |
PRNP-7569H | Recombinant Human PRNP, His-tagged | +Inquiry |
Prnp-802B | Recombinant Bovine Prion Protein (Q228R), His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PRNP-001HCL | Recombinant Human PRNP cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Prnp Products
Required fields are marked with *
My Review for All Prnp Products
Required fields are marked with *
0
Inquiry Basket