Recombinant Helicobacter Pylori FTNA Protein (1-167 aa), His-tagged

Cat.No. : FTNA-2570H
Product Overview : Recombinant Helicobacter Pylori (strain ATCC 700392/26695) (Campylobacter pylori) FTNA Protein (1-167 aa) is produced by E. coli expression system. This protein is fused with a 10xHis tag at the N-terminal. Protein Description: Full Length.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Helicobacter Pylori
Source : E.coli
Tag : His
Protein Length : 1-167 aa
Description : Iron-storage protein.
Form : Tris-based buffer,50% glycerol
Molecular Mass : 24.8 kDa
AA Sequence : MLSKDIIKLLNEQVNKEMNSSNLYMSMSSWCYTHSLDGAGLFLFDHAAEEYEHAKKLIVFLNENNVPVQLTSISAPEHKFEGLTQIFQKAYEHEQHISESINNIVDHAIKGKDHATFNFLQWYVSEQHEEEVLFKDILDKIELIGNENHGLYLADQYVKGIAKSRKS
Purity : > 85% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA will be sent along with the products. Please refer to it for detailed information.
Synonyms ftnA;
UniProt ID P52093

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All FTNA Products

Required fields are marked with *

My Review for All FTNA Products

Required fields are marked with *

0
cart-icon
0
compare icon