Recombinant Helicobacter Pylori FTNA Protein (1-167 aa), His-tagged

• Cat.No.: FTNA-2744H
• Product Overview: Recombinant Helicobacter Pylori (strain ATCC 700392/26695) (Campylobacter pylori) FTNA Protein (1-167 aa) is produced by Baculovirus expression system. This protein is fused with a 10xHis tag at the N-terminal. Protein Description: Full Length.

Specification

• Species: Helicobacter Pylori
• Source: Insect Cells
• Tag: His
• Protein Length: 1-167 aa
• Description: Iron-storage protein.
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 21.8 kDa
• AA Sequence: MLSKDIIKLLNEQVNKEMNSSNLYMSMSSWCYTHSLDGAGLFLFDHAAEEYEHAKKLIVFLNENNVPVQLTSISAPEHKFEGLTQIFQKAYEHEQHISESINNIVDHAIKGKDHATFNFLQWYVSEQHEEEVLFKDILDKIELIGNENHGLYLADQYVKGIAKSRKS
• Purity: > 85% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA will be sent along with the products. Please refer to it for detailed information.

Gene Information

• Synonyms: ftnA
• UniProt ID: P52093