Recombinant Horse CKM protein
Cat.No. : | CKM-575H |
Product Overview : | Recombinant Horse CKM protein(F7BR99)(136-381aa) was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Horse |
Source : | E.coli |
Tag : | Non |
Protein Length : | 136-381aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 27.9 kDa |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | SIKGYTLPPHCSRGERRAVEKLSVEALNSLTGEFKGKYYPLKSMTEQEQQQLIDDHFLFDKPVSPLLLASGMARDWPDARGIWHNDNKSFLVWVNEEDHLRVISMEKGGNMKEVFRRFCVGLQKIEEIFKKAGHPFMWNEHLGYVLTCPSNLGTGLRGGVHVKLAHLSKHPKFEEILKRLRLQKRGTGGVDTAAVGSVFDVSNADRLGSSEVEQVQLVVDGVKLMVEMEKKLEKGQSIDDMIPAQK |
◆ Recombinant Proteins | ||
CKM-1397H | Recombinant Human CKM Protein, GST-tagged | +Inquiry |
CKM-116H | Recombinant Human CKM, His tagged | +Inquiry |
CKM-932H | Recombinant Human Creatine Kinase, Muscle | +Inquiry |
CKM-11265H | Recombinant Human CKM protein, His-tagged | +Inquiry |
CKM-1078R | Recombinant Rat CKM Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
CKM-368P | Native Pig Creatine Kinase, Muscle | +Inquiry |
CKMM-166M | Native Mouse Creatine Kinase MM | +Inquiry |
Ckmm-167R | Native Rat Creatine Kinase MM | +Inquiry |
CKM-26522TH | Native Human CKM | +Inquiry |
CKMM-382H | Native Human Creatine Kinase MM (CK-MM) | +Inquiry |
◆ Cell & Tissue Lysates | ||
CKM-7483HCL | Recombinant Human CKM 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CKM Products
Required fields are marked with *
My Review for All CKM Products
Required fields are marked with *