Recombinant Human CKM Protein, His-tagged

Cat.No. : CKM-317H
Product Overview : Recombinant Human CKM fused with His tag at C-terminal was expressed in HEK293.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : His
Description : The protein encoded by this gene is a cytoplasmic enzyme involved in energy homeostasis and is an important serum marker for myocardial infarction. The encoded protein reversibly catalyzes the transfer of phosphate between ATP and various phosphogens such as creatine phosphate. It acts as a homodimer in striated muscle as well as in other tissues, and as a heterodimer with a similar brain isozyme in heart. The encoded protein is a member of the ATP:guanido phosphotransferase protein family.
Form : Supplied as a 0.2 µM filtered solution of 20mM TrisHCl, 150mM NaCl, 10%Glycerol, pH7.5
Molecular Mass : 44.1kD
Identity : Endotoxin level is <0.1 ng/µg of protein (<1EU/µg).
AA Sequence : MPFGNTHNKFKLNYKPEEEYPDLSKHNNHMAKVLTLELYKKLRDKETPSGFTVDDVIQTGVDNPGHPFIMTVGCVAGDEESYEVFKELFDPIISDRHGGYKPTDKHKTDLNHENLKGGDDLDPNYVLSSRVRTGRSIKGYTLPPHCSRGERRAVEKLSVEALNSLTGEFKGKYYPLKSMTEKEQQQLIDDHFLFDKPVSPLLLASGMARDWPDARGIWHNDNKSLLVWVNEEDHLRVISMEKGGNMKEVFRRFCVGLQKIEEIFKKAGHPFMWNQHLGYVLTCPSNLGTGLRGGVHVKLAHLSKHPKFEEILTRLRLQKRGTGGVDTAAVGSVFDVSNADRLGSSEVEQVQLVVDGVKLMVEMEKKLEKGQSIDDMIPAQKVDHHHHHH*
Purity : >95% as determined by SDS-PAGE and Coomassie blue staining
Gene Name CKM creatine kinase, muscle [ Homo sapiens ]
Official Symbol CKM
Synonyms CKM; creatine kinase, muscle; CKMM; creatine kinase M-type; creatine kinase-M; creatine kinase M chain; M-CK;
Gene ID 1158
mRNA Refseq NM_001824
Protein Refseq NP_001815
MIM 123310
UniProt ID P06732

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CKM Products

Required fields are marked with *

My Review for All CKM Products

Required fields are marked with *

0

Inquiry Basket

cartIcon