Recombinant Mouse Ckm protein, His-tagged
| Cat.No. : | Ckm-6442M |
| Product Overview : | Recombinant Mouse Ckm protein(P07310)(1-381aa), fused with N-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-381aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 49.0 kDa |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
| AA Sequence : | MPFGNTHNKFKLNYKPQEEYPDLSKHNNHMAKVLTPDLYNKLRDKETPSGFTLDDVIQTGVDNPGHPFIMTVGCVAGDEESYTVFKDLFDPIIQDRHGGYKPTDKHKTDLNHENLKGGDDLDPNYVLSSRVRTGRSIKGYTLPPHCSRGERRAVEKLSVEALNSLTGEFKGKYYPLKSMTEQEQQQLIDDHFLFDKPVSPLLLASGMARDWPDARGIWHNDNKSFLVWVNEEDHLRVISMEKGGNMKEVFRRFCVGLQKIEEIFKKAGHPFMWNEHLGYVLTCPSNLGTGLRGGVHVKLANLSKHPKFEEILTRLRLQKRGTGGVDTAAVGAVFDISNADRLGSSEVEQVQLVVDGVKLMVEMEKKLEKGQSIDDMIPAQK |
| Gene Name | Ckm creatine kinase, muscle [ Mus musculus ] |
| Official Symbol | Ckm |
| Synonyms | CKM; creatine kinase, muscle; creatine kinase M-type; creatine kinase M chain; MCK; Ckmm; M-CK; |
| Gene ID | 12715 |
| mRNA Refseq | NM_007710 |
| Protein Refseq | NP_031736 |
| ◆ Recombinant Proteins | ||
| CKM-674C | Recombinant Cat CKM protein | +Inquiry |
| CKM-7056C | Recombinant Chicken CKM | +Inquiry |
| CKM-198H | Recombinant Human Creatine Kinase, Muscle, Type3 | +Inquiry |
| CKM-793R | Recombinant Rabbit CKM Protein, His-tagged | +Inquiry |
| CKM-2571H | Recombinant Human CKM protein(21-120 aa), C-His-tagged | +Inquiry |
| ◆ Native Proteins | ||
| CKMM-166M | Native Mouse Creatine Kinase MM | +Inquiry |
| Ckmm-167R | Native Rat Creatine Kinase MM | +Inquiry |
| CKMM-382H | Native Human Creatine Kinase MM (CK-MM) | +Inquiry |
| CKM-5305H | Native Human creatine kinase, muscle | +Inquiry |
| CKM-368P | Native Pig Creatine Kinase, Muscle | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CKM-7483HCL | Recombinant Human CKM 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Ckm Products
Required fields are marked with *
My Review for All Ckm Products
Required fields are marked with *
