Recombinant Horse MSTN protein, His-tagged
| Cat.No. : | MSTN-4363H |
| Product Overview : | Recombinant Horse MSTN protein(Q9GM97)(267-375aa), fused with N-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Horse |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 267-375aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 18.4 kDa |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
| AA Sequence : | DFGLDCDEHSTESRCCRYPLTVDFEAFGWDWIIAPKRYKANYCSGECEFVFLQKYPHTHLVHQANPRGSAGPCCTPTKMSPINMLYFNGKEQIIYGKIPAMVVDRCGCS |
| Gene Name | MSTN myostatin [ Equus caballus ] |
| Official Symbol | MSTN |
| Synonyms | MSTN; myostatin; growth/differentiation factor 8; GDF-8; |
| Gene ID | 100033832 |
| mRNA Refseq | NM_001081817 |
| Protein Refseq | NP_001075286 |
| ◆ Recombinant Proteins | ||
| MSTN-118H | Recombinant Human Myostatin | +Inquiry |
| Mstn-91M | Recombinant Mouse Mstn Protein, His (Fc)-Avi-tagged | +Inquiry |
| MSTN-2458H | Recombinant Human MSTN Protein, His-tagged | +Inquiry |
| MSTN-3340H | Recombinant Human MSTN Protein (Lys262-Ser375) | +Inquiry |
| MSTN-4363H | Recombinant Horse MSTN protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| MSTN-2229MCL | Recombinant Mouse MSTN cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MSTN Products
Required fields are marked with *
My Review for All MSTN Products
Required fields are marked with *
