Recombinant Horse VEGFA protein, His&Myc-tagged
| Cat.No. : | VEGFA-6844H |
| Product Overview : | Recombinant Horse VEGFA protein(Q9GKR0)(27-190aa), fused with N-terminal His tag and C-terminal Myc tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Horse |
| Source : | E.coli |
| Tag : | His&Myc |
| Protein Length : | 27-190a.a. |
| Tag : | His&Myc |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 26.6 kDa |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
| AA Sequence : | APMAEGEHKTHEVVKFMDVYQRSYCRPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTAEFNITMQIMRIKPHQSQHIGEMSFLQHSKCECRPKKDKARQENPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR |
| Gene Name | VEGFA vascular endothelial growth factor A [ Equus caballus ] |
| Official Symbol | VEGFA |
| Synonyms | VEGFA; vascular endothelial growth factor A; VPF; VEGF-A; vascular permeability factor; vascular endothelial growth factor 164; |
| Gene ID | 100033839 |
| mRNA Refseq | NM_001081821 |
| Protein Refseq | NP_001075290 |
| ◆ Recombinant Proteins | ||
| VEGFA-P1003H | Recombinant Human VEGFA | +Inquiry |
| VEGFA-637F | Active Recombinant Feline VEGFA, Met-tagged | +Inquiry |
| VEGFA-325H | Recombinant Active Human VEGFA (VEGF165) Protein, His-tagged(C-ter) | +Inquiry |
| VEGFA-270C | Active Recombinant Canine VEGFA | +Inquiry |
| VEGFA-31560TH | Recombinant Human VEGFA, His-tagged | +Inquiry |
| ◆ Native Proteins | ||
| VEGFA-31701TH | Native Human VEGFA | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| VEGFA-647MCL | Recombinant Mouse VEGFA cell lysate | +Inquiry |
| VEGFA-1427HCL | Recombinant Human VEGFA cell lysate | +Inquiry |
| VEGFA-727HCL | Recombinant Human VEGFA cell lysate | +Inquiry |
| VEGFA-969CCL | Recombinant Canine VEGFA cell lysate | +Inquiry |
| VEGFA-522RCL | Recombinant Rat VEGFA cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All VEGFA Products
Required fields are marked with *
My Review for All VEGFA Products
Required fields are marked with *



