| Species : |
HPV11 |
| Source : |
E.coli |
| Form : |
Lyophilized |
| Molecular Mass : |
~ 23.8 kDa |
| AA Sequence : |
MVMLTCHLNDGDTWLFLWLFTAFVVAVLGLLLLHYRAVHGTEKTKCAKCKSNRNTTVDYVYMSHGDNGDYVYMN |
| Purity : |
≥85%, by SDS-PAGE |
| Stability : |
-20 to -80 centigrade, six months from the date of receipt |
| Storage : |
Store at -20 centigrade, for extended storage, conserve at -20 or -80 centigrade. Avoid freeze/thaw cycles. |
| Storage Buffer : |
Lyophilized from 10 mM Tris-HCl, 1 mM EDTA, 6% Trehalose, pH 8.0. The volume before lyophilization is 50μl/vial. |
| Reconstitution : |
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/ml. We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20/-80 centigrade. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
