Recombinant HPV-6 E7 Protein, His tagged

Cat.No. : E7-1694H
Product Overview : Recombinant HPV-6 E7 Protein with His tag was expressed in E. coli.
Availability June 15, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : HPV6
Source : E.coli
Tag : His
Description : Human papillomavirus (HPV) is a common virus that can affect different parts of your body. There are over 100 types of HPV, including strains of HPV that cause warts on your hands, feet, face, etc. About 30 HPV strains can affect your genitals, including your vulva, vagina, cervix, penis and scrotum, as well as your rectum and anus.
Molecular Mass : The protein has a calculated MW of 12 kDa.
AA Sequence : MHGRHVTLKDIVLDLQPPDPVGLHCYEQLVDSSEDEVDEVDGQDSQPLKQHFQIVTCCCGCDSNVRLVVQCTETDIREVQQLLLGTLNIVCPICAPKTLEHHHHHH
Purity : > 95% by SDS-PAGE
Storage : Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Concentration : 1.7 mg/mL by BCA
Storage Buffer : Sterile 100 mM Tris, 400 mM Arginine, pH 8.0
Official Symbol E7
Synonyms E7

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All E7 Products

Required fields are marked with *

My Review for All E7 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon