Recombinant HPV16 E7 protein, GST-tagged

Cat.No. : E7-669H
Product Overview : Recombinant HPV16 E7 protein (1-98 aa) with GST tag was expressed in E. coli.
Availability October 03, 2026
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : HPV16
Source : E.coli
Tag : GST
Protein Length : 1-98 aa
Description : Plays a role in viral genome replication by driving entry of quiescent cells into the cell cycle. Stimulation of progression from G1 to S phase allows the virus to efficiently use the cellular DNA replicating machinery to achieve viral genome replication. E7 protein has both transforming and trans-activating activities. Induces the disassembly of the E2F1 transcription factor from RB1, with subsequent transcriptional activation of E2F1-regulated S-phase genes. Interferes with host histone deacetylation mediated by HDAC1 and HDAC2, leading to transcription activation. Also plays a role in the inhibition of both antiviral and antiproliferative functions of host interferon alpha. Interaction with host TMEM173/STING impairs the ability of TMEM173/STING to sense cytosolic DNA and promote the production of type I interferon (IFN-alpha and IFN-beta).
Form : Sterile PBS, pH 7.4
Molecular Mass : 37 kDa
AASequence : MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLEVLFQGPLGSMHGDTPTLHEYMLDLQPETTDLYCYEQLNDSSEEEDEIDGPAGQAEPDRAHYNIVTFCCKCDSTLRLCVQSTHVDIRTLEDLLMGTLGIVCPICSQKP
Endotoxin : < 0.1 EU/μg by LAL
Purity : >80% by SDS-PAGE
Storage : Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Concentration : 0.28 mg/mL by Bradford
Gene Name E7 transforming protein E7 [ Human papillomavirus 16 ]
Official Symbol E7
Synonyms E7; transforming protein E7; transforming protein E7; E7. Plays a role in viral genome replication by driving entry of quiescent cells into the cell cycle
Gene ID 1489079
Protein Refseq NP_041326
UniProt ID P03129

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All E7 Products

Required fields are marked with *

My Review for All E7 Products

Required fields are marked with *

0
cart-icon
0
compare icon