Recombinant HPV16 E7 protein, GST-tagged

• Cat.No.: E7-669H
• Product Overview: Recombinant HPV16 E7 protein (1-98 aa) with GST tag was expressed in E. coli.

Specification

• Species: HPV16
• Source: E.coli
• Tag: GST
• Protein Length: 1-98 aa
• Description: Plays a role in viral genome replication by driving entry of quiescent cells into the cell cycle. Stimulation of progression from G1 to S phase allows the virus to efficiently use the cellular DNA replicating machinery to achieve viral genome replication. E7 protein has both transforming and trans-activating activities. Induces the disassembly of the E2F1 transcription factor from RB1, with subsequent transcriptional activation of E2F1-regulated S-phase genes. Interferes with host histone deacetylation mediated by HDAC1 and HDAC2, leading to transcription activation. Also plays a role in the inhibition of both antiviral and antiproliferative functions of host interferon alpha. Interaction with host TMEM173/STING impairs the ability of TMEM173/STING to sense cytosolic DNA and promote the production of type I interferon (IFN-alpha and IFN-beta).
• Form: Sterile PBS, pH 7.4
• Molecular Mass: 37 kDa
• AASequence: MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLEVLFQGPLGSMHGDTPTLHEYMLDLQPETTDLYCYEQLNDSSEEEDEIDGPAGQAEPDRAHYNIVTFCCKCDSTLRLCVQSTHVDIRTLEDLLMGTLGIVCPICSQKP
• Endotoxin: < 0.1 EU/μg by LAL
• Purity: >80% by SDS-PAGE
• Storage: Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
• Concentration: 0.28 mg/mL by Bradford

Gene Information

• Gene Name: E7 transforming protein E7 [ Human papillomavirus 16 ]
• Official Symbol: E7
• Synonyms: E7; transforming protein E7; transforming protein E7; E7. Plays a role in viral genome replication by driving entry of quiescent cells into the cell cycle
• Gene ID: 1489079
• Protein Refseq: NP_041326
• UniProt ID: P03129