Recombinant HPV16 E7 protein, GST-tagged
| Cat.No. : | E7-669H |
| Product Overview : | Recombinant HPV16 E7 protein (1-98 aa) with GST tag was expressed in E. coli. |
| Availability | August 23, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | HPV16 |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 1-98 aa |
| Description : | Plays a role in viral genome replication by driving entry of quiescent cells into the cell cycle. Stimulation of progression from G1 to S phase allows the virus to efficiently use the cellular DNA replicating machinery to achieve viral genome replication. E7 protein has both transforming and trans-activating activities. Induces the disassembly of the E2F1 transcription factor from RB1, with subsequent transcriptional activation of E2F1-regulated S-phase genes. Interferes with host histone deacetylation mediated by HDAC1 and HDAC2, leading to transcription activation. Also plays a role in the inhibition of both antiviral and antiproliferative functions of host interferon alpha. Interaction with host TMEM173/STING impairs the ability of TMEM173/STING to sense cytosolic DNA and promote the production of type I interferon (IFN-alpha and IFN-beta). |
| Form : | Sterile PBS, pH 7.4 |
| Molecular Mass : | 37 kDa |
| AASequence : | MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLEVLFQGPLGSMHGDTPTLHEYMLDLQPETTDLYCYEQLNDSSEEEDEIDGPAGQAEPDRAHYNIVTFCCKCDSTLRLCVQSTHVDIRTLEDLLMGTLGIVCPICSQKP |
| Endotoxin : | < 0.1 EU/μg by LAL |
| Purity : | >80% by SDS-PAGE |
| Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
| Concentration : | 0.28 mg/mL by Bradford |
| Gene Name | E7 transforming protein E7 [ Human papillomavirus 16 ] |
| Official Symbol | E7 |
| Synonyms | E7; transforming protein E7; transforming protein E7; E7. Plays a role in viral genome replication by driving entry of quiescent cells into the cell cycle |
| Gene ID | 1489079 |
| Protein Refseq | NP_041326 |
| UniProt ID | P03129 |
| ◆ Recombinant Proteins | ||
| E7-4258H | Recombinant Human papillomavirus type 16 E7 protein, His-tagged | +Inquiry |
| E7-10H | Active Recombinant Full Length HPV E7 Protein, His tagged | +Inquiry |
| E7-1692H | Recombinant HPV-41 E7 Protein | +Inquiry |
| E7-1689H | Recombinant HPV-18 E7 Protein | +Inquiry |
| E7-1694H | Recombinant HPV-6 E7 Protein, His tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All E7 Products
Required fields are marked with *
My Review for All E7 Products
Required fields are marked with *



