Recombinant HPV18 major capsid L1 protein, His-tagged
Cat.No. : | L1-01H |
Product Overview : | Recombinant HPV18 major capsid L1 protein with C-terminal His6 fusion tag was expressed in E. coli. |
Availability | October 10, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human Papillomavirus Type 18 |
Source : | E.coli |
Tag : | His |
Protein Length : | 527 |
Description : | Forms an icosahedral capsid with a T=7 symmetry and a 50 nm diameter. The capsid is composed of 72 pentamers linked to each other by disulfide bonds and associated with L2 proteins. Binds to heparan sulfate proteoglycans on cell surface of basal layer keratinocytes to provide initial virion attachment. This binding mediates a conformational change in the virus capsid that facilitates efficient infection. The virion enters the host cell via endocytosis. During virus trafficking, L1 protein dissociates from the viral DNA and the genomic DNA is released to the host nucleus. The virion assembly takes place within the cell nucleus. Encapsulates the genomic DNA together with protein L2. |
Form : | Buffered aqueous solution |
Molecular Mass : | 58.9 kDa |
AA Sequence : | MRNVNVFPIFLQMALWRPSDNTVYLPPPSVARVVNTDDYVTPTSIFYHAGSSRLLTVGNPYFRVPAGGGNKQDIPKVSAYQYRVFRVQLPDPNKFGLPDTSIYNPETQRLVWACAGVEIGRGQPLGVGLSGHPFYNKLDDTESSHAATSNVSEDVRDNVSVDYKQTQLCILGCAPAIGEHWAKGTACKSRPLSQGDCPPLELKNTVLEDGDMVDTGYGAMDFSTLQDTKCEVPLDICQSICKYPDYLQMSADPYGDSMFFCLRREQLFARHFWNRAGTMGDTVPQSLYIKGTGMPASPGSCVYSPSPSGSIVTSDSQLFNKPYWLHKAQGHNNGVCWHNQLFVTVVDTTPSTNLTICASTQSPVPGQYDATKFKQYSRHVEEYDLQFIFQLCTITLTADVMSYIHSMNSSILEDWNFGVPPPPTTSLVDTYRFVQSVAITCQKDAAPAENKDPYDKLKFWNVDLKEKFSLDLDQYPLGRKFLVQAGLRRKPTIGPRKRSAPSATTSSKPAKRVRVRARKHHHHHHHH |
Endotoxin : | <1EU/ug by LAL |
Purity : | >90% by SDS-PAGE |
Applications : | Antigen for antibody production ELISA |
Storage : | Store it under sterile conditions at -20 to -80 ºC. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Concentration : | 0.98 mg/ml |
Storage Buffer : | Solution in PBS, 0.05%SKL, pH7.4 |
Gene Name | L1 |
Official Symbol | major capsid L1 protein |
Synonyms | major capsid L1 protein |
Gene ID | 1489090 |
mRNA Refseq | X05015.1 |
Protein Refseq | NP_040317.1 |
UniProt ID | P06794 |
◆ Recombinant Proteins | ||
L1-01H | Recombinant HPV18 major capsid L1 protein, His-tagged | +Inquiry |
L1-05H | Recombinant HPV58 major capsid L1 Protein, His-tagged | +Inquiry |
HPV16-L1-10H | Recombinant HPV16 L1 Protein, His tagged | +Inquiry |
L1-4203H | Recombinant Human papillomavirus type 18 L1 protein, His-tagged | +Inquiry |
L1-1725H | Recombinant HPV-53 L1 Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All L1 Products
Required fields are marked with *
My Review for All L1 Products
Required fields are marked with *