Recombinant Human papillomavirus 45 L1 Protein, His-tagged
Cat.No. : | L1-46H |
Product Overview : | Human papillomavirus 45 Protein, fused to His-tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human papillomavirus 45 |
Source : | E.coli |
Tag : | His |
Description : | major capsid L1 protein |
Form : | PBS, pH7.4. |
Molecular Mass : | 58 kDa |
AA Sequence : | MRPSDSTVYLPPPSVARVVSTDDYVSRTSIFYHAGSSRLLTVGNPYFRVVPNGAGNKQAVPKVSAYQYRVFRVALPDPNKFGLPDSTIYNPETQRLVWACVGMEIGRGQPLGIGLSGHPFYNKLDDTESAHAATAVITQDVRDNVSVDYKQTQLCILGCVPAIGEHWAKGTLCKPAQLQPGDCPPLELKNTIIEDGDMVDTGYGAMDFSTLQDTKCEVPLDICQSICKYPDYLQMSADPYGDSMFFCLRREQLFARHFWNRAGVMGDTVPTDLYIKGTSANMRETPGSCVYSPSPSGSIITSDSQLFNKPYWLHKAQGHNNGICWHNQLFVTVVDTTRSTNLTLCASTQNPVPSTYDPTKFKQYSRHVEEYDLQFIFQLCTITLTAEVMSYIHSMNSSILENWNFGVPPPPTTSLVDTYRFVQSVAVTCQKDTTPPEKQDPYDKLKFWTVDLKEKFSSDLDQYPLGRKFLVQAGLRRRPTIGPRKRPAASTSTASTASRPAKRVRIRSKKHHHHHHHH |
Endotoxin : | <1EU/ug |
Purity : | >90% |
Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Concentration : | 0.14 mg/ml |
Gene Name | L1 major capsid protein L1 [ Human papillomavirus type 48 ] |
Official Symbol | L1 |
Gene ID | 1403627 |
Protein Refseq | NP_043422 |
UniProt ID | P36741 |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All L1 Products
Required fields are marked with *
My Review for All L1 Products
Required fields are marked with *
0
Inquiry Basket