Recombinant Human A4GALT Protein, GST-tagged

Cat.No. : A4GALT-005H
Product Overview : Human A4GALT partial ORF ( NP_059132, 254 a.a. - 353 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : The protein encoded by this gene catalyzes the transfer of galactose to lactosylceramide to form globotriaosylceramide, which has been identified as the P(k) antigen of the P blood group system. This protein, a type II membrane protein found in the Golgi, is also required for the synthesis of the bacterial verotoxins receptor. Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Dec 2015]
Molecular Mass : 36.74 kDa
AA Sequence : LTRVFKKWCSIRSLAESRACRGVTTLPPEAFYPIPWQDWKKYFEDINPEELPRLLSATYAVHVWNKKSQGTRFEATSRALLAQLHARYCPTTHEAMKMYL
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name A4GALT alpha 1,4-galactosyltransferase [ Homo sapiens ]
Official Symbol A4GALT
Synonyms A4GALT; alpha 1,4-galactosyltransferase; alpha 1,4 galactosyltransferase (globotriaosylceramide synthase, P blood group); lactosylceramide 4-alpha-galactosyltransferase; A14GALT; CD77 synthase; Gb3 synthase; Gb3S; globotriaosylceramide synthase; P(k); GB3 synthase; alpha4Gal-T1; P1/Pk synthase; P(k) antigen synthase; P blood group (P one antigen); alpha-1,4-N-acetylglucosaminyltransferase; UDP-galactose:beta-D-galactosyl-beta1-R 4-alpha-D-galactosyltransferase; P1; PK; A4GALT1;
Gene ID 53947
mRNA Refseq NM_017436
Protein Refseq NP_059132
MIM 607922
UniProt ID Q9NPC4

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All A4GALT Products

Required fields are marked with *

My Review for All A4GALT Products

Required fields are marked with *

0

Inquiry Basket

cartIcon