Recombinant Human A4GALT Protein, GST-tagged
Cat.No. : | A4GALT-005H |
Product Overview : | Human A4GALT partial ORF ( NP_059132, 254 a.a. - 353 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The protein encoded by this gene catalyzes the transfer of galactose to lactosylceramide to form globotriaosylceramide, which has been identified as the P(k) antigen of the P blood group system. This protein, a type II membrane protein found in the Golgi, is also required for the synthesis of the bacterial verotoxins receptor. Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Dec 2015] |
Molecular Mass : | 36.74 kDa |
AA Sequence : | LTRVFKKWCSIRSLAESRACRGVTTLPPEAFYPIPWQDWKKYFEDINPEELPRLLSATYAVHVWNKKSQGTRFEATSRALLAQLHARYCPTTHEAMKMYL |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | A4GALT alpha 1,4-galactosyltransferase [ Homo sapiens ] |
Official Symbol | A4GALT |
Synonyms | A4GALT; alpha 1,4-galactosyltransferase; alpha 1,4 galactosyltransferase (globotriaosylceramide synthase, P blood group); lactosylceramide 4-alpha-galactosyltransferase; A14GALT; CD77 synthase; Gb3 synthase; Gb3S; globotriaosylceramide synthase; P(k); GB3 synthase; alpha4Gal-T1; P1/Pk synthase; P(k) antigen synthase; P blood group (P one antigen); alpha-1,4-N-acetylglucosaminyltransferase; UDP-galactose:beta-D-galactosyl-beta1-R 4-alpha-D-galactosyltransferase; P1; PK; A4GALT1; |
Gene ID | 53947 |
mRNA Refseq | NM_017436 |
Protein Refseq | NP_059132 |
MIM | 607922 |
UniProt ID | Q9NPC4 |
◆ Recombinant Proteins | ||
A4GALT-005H | Recombinant Human A4GALT Protein, GST-tagged | +Inquiry |
A4galt-484M | Recombinant Mouse A4galt Protein, His-tagged | +Inquiry |
A4GALT-9187H | Recombinant Human A4GALT protein, GST-tagged | +Inquiry |
A4GALT-574HF | Recombinant Full Length Human A4GALT Protein, GST-tagged | +Inquiry |
A4GALT-5510C | Recombinant Chicken A4GALT | +Inquiry |
◆ Native Proteins | ||
A4GALT-01HM | Recombinant Human A4GALT (Q211E) Protein, His Tagged, Mutant | +Inquiry |
◆ Cell & Tissue Lysates | ||
A4GALT-9163HCL | Recombinant Human A4GALT 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All A4GALT Products
Required fields are marked with *
My Review for All A4GALT Products
Required fields are marked with *