Recombinant Human A4GALT Protein, GST-tagged

• Cat.No.: A4GALT-005H
• Product Overview: Human A4GALT partial ORF ( NP_059132, 254 a.a. - 353 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: The protein encoded by this gene catalyzes the transfer of galactose to lactosylceramide to form globotriaosylceramide, which has been identified as the P(k) antigen of the P blood group system. This protein, a type II membrane protein found in the Golgi, is also required for the synthesis of the bacterial verotoxins receptor. Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Dec 2015]
• Molecular Mass: 36.74 kDa
• AA Sequence: LTRVFKKWCSIRSLAESRACRGVTTLPPEAFYPIPWQDWKKYFEDINPEELPRLLSATYAVHVWNKKSQGTRFEATSRALLAQLHARYCPTTHEAMKMYL
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: A4GALT alpha 1,4-galactosyltransferase [ Homo sapiens ]
• Official Symbol: A4GALT
• Synonyms: A4GALT; alpha 1,4-galactosyltransferase; alpha 1,4 galactosyltransferase (globotriaosylceramide synthase, P blood group); lactosylceramide 4-alpha-galactosyltransferase; A14GALT; CD77 synthase; Gb3 synthase; Gb3S; globotriaosylceramide synthase; P(k); GB3 synthase; alpha4Gal-T1; P1/Pk synthase; P(k) antigen synthase; P blood group (P one antigen); alpha-1,4-N-acetylglucosaminyltransferase; UDP-galactose:beta-D-galactosyl-beta1-R 4-alpha-D-galactosyltransferase; P1; PK; A4GALT1
• Gene ID: 53947
• mRNA Refseq: NM_017436
• Protein Refseq: NP_059132
• MIM: 607922
• UniProt ID: Q9NPC4