Recombinant Human AADAT Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : AADAT-2116H
Product Overview : AADAT MS Standard C13 and N15-labeled recombinant protein (NP_872603) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : This gene encodes a protein that is highly similar to mouse and rat kynurenine aminotransferase II. The rat protein is a homodimer with two transaminase activities. One activity is the transamination of alpha-aminoadipic acid, a final step in the saccaropine pathway which is the major pathway for L-lysine catabolism. The other activity involves the transamination of kynurenine to produce kynurenine acid, the precursor of kynurenic acid which has neuroprotective properties. Several transcript variants encoding two different isoforms have been found for this gene.
Molecular Mass : 47.2 kDa
AA Sequence : MNYARFITAASAARNPSPIRTMTDILSRGPKSMISLAGGLPNPNMFPFKTAVITVENGKTIQFGEEMMKRALQYSPSAGIPELLSWLKQLQIKLHNPPTIHYPPSQGQMDLCVTSGSQQGLCKVFEMIINPGDNVLLDEPAYSGTLQSLHPLGCNIINVASDESGIVPDSLRDILSRWKPEDAKNPQKNTPKFLYTVPNGNNPTGNSLTSERKKEIYELARKYDFLIIEDDPYYFLQFNKFRVPTFLSMDVDGRVIRADSFSKIISSGLRIGFLTGPKPLIERVILHIQVSTLHPSTFNQLMISQLLHEWGEEGFMAHVDRVIDFYSNQKDAILAAADKWLTGLAEWHVPAAGMFLWIKVKGINDVKELIEEKAVKMGVLMLPGNAFYVDSSAPSPYLRASFSSASPEQMDVAFQVLAQLIKESLTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name AADAT aminoadipate aminotransferase [ Homo sapiens (human) ]
Official Symbol AADAT
Synonyms AADAT; aminoadipate aminotransferase; kynurenine/alpha-aminoadipate aminotransferase, mitochondrial; KAT2; KATII; kynurenine aminotransferase II; L kynurenine/alpha aminoadipate aminotransferase; KAT/AadAT; 2-aminoadipate transaminase; 2-aminoadipate aminotransferase; alpha-aminoadipate aminotransferase; kynurenine--oxoglutarate transaminase II; kynurenine--oxoglutarate aminotransferase II;
Gene ID 51166
mRNA Refseq NM_182662
Protein Refseq NP_872603
MIM 611754
UniProt ID Q8N5Z0

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All AADAT Products

Required fields are marked with *

My Review for All AADAT Products

Required fields are marked with *

0

Inquiry Basket

cartIcon