Recombinant Human AADAT Protein, Myc/DDK-tagged, C13 and N15-labeled
| Cat.No. : | AADAT-2116H |
| Product Overview : | AADAT MS Standard C13 and N15-labeled recombinant protein (NP_872603) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | DDK&Myc |
| Description : | This gene encodes a protein that is highly similar to mouse and rat kynurenine aminotransferase II. The rat protein is a homodimer with two transaminase activities. One activity is the transamination of alpha-aminoadipic acid, a final step in the saccaropine pathway which is the major pathway for L-lysine catabolism. The other activity involves the transamination of kynurenine to produce kynurenine acid, the precursor of kynurenic acid which has neuroprotective properties. Several transcript variants encoding two different isoforms have been found for this gene. |
| Molecular Mass : | 47.2 kDa |
| AA Sequence : | MNYARFITAASAARNPSPIRTMTDILSRGPKSMISLAGGLPNPNMFPFKTAVITVENGKTIQFGEEMMKRALQYSPSAGIPELLSWLKQLQIKLHNPPTIHYPPSQGQMDLCVTSGSQQGLCKVFEMIINPGDNVLLDEPAYSGTLQSLHPLGCNIINVASDESGIVPDSLRDILSRWKPEDAKNPQKNTPKFLYTVPNGNNPTGNSLTSERKKEIYELARKYDFLIIEDDPYYFLQFNKFRVPTFLSMDVDGRVIRADSFSKIISSGLRIGFLTGPKPLIERVILHIQVSTLHPSTFNQLMISQLLHEWGEEGFMAHVDRVIDFYSNQKDAILAAADKWLTGLAEWHVPAAGMFLWIKVKGINDVKELIEEKAVKMGVLMLPGNAFYVDSSAPSPYLRASFSSASPEQMDVAFQVLAQLIKESLTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
| Concentration : | 50 μg/mL as determined by BCA |
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
| Gene Name | AADAT aminoadipate aminotransferase [ Homo sapiens (human) ] |
| Official Symbol | AADAT |
| Synonyms | AADAT; aminoadipate aminotransferase; kynurenine/alpha-aminoadipate aminotransferase, mitochondrial; KAT2; KATII; kynurenine aminotransferase II; L kynurenine/alpha aminoadipate aminotransferase; KAT/AadAT; 2-aminoadipate transaminase; 2-aminoadipate aminotransferase; alpha-aminoadipate aminotransferase; kynurenine--oxoglutarate transaminase II; kynurenine--oxoglutarate aminotransferase II; |
| Gene ID | 51166 |
| mRNA Refseq | NM_182662 |
| Protein Refseq | NP_872603 |
| MIM | 611754 |
| UniProt ID | Q8N5Z0 |
| ◆ Recombinant Proteins | ||
| AADAT-301515H | Recombinant Human AADAT protein, GST-tagged | +Inquiry |
| AADAT-4693H | Recombinant Human AADAT protein, His-SUMO-tagged | +Inquiry |
| AADAT-570HFL | Active Recombinant Full Length Human AADAT Protein, C-Flag-tagged | +Inquiry |
| AADAT-1032H | Recombinant Human AADAT protein, His & T7-tagged | +Inquiry |
| AADAT-382R | Recombinant Rat AADAT Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| AADAT-9158HCL | Recombinant Human AADAT 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All AADAT Products
Required fields are marked with *
My Review for All AADAT Products
Required fields are marked with *
