Recombinant Human AAMDC Protein, His-tagged
Cat.No. : | AAMDC-333H |
Product Overview : | Recombinant Human AAMDC Protien(NP_001303886.1)(1-122 aa), fused to His tag, was expressed in E. coli. |
Availability | June 06, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-122 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.). 5 % trehalose and 5 % mannitol are added as protectants before lyophilization. |
AA Sequence : | MTSPEIASLSWGQMKVKGSNTTYKDCKVWPGGSRTWDWRETGTEHSPGVQPADVKEVVEKGVQTLVIGRGMSEALKVPSSTVEYLKKHGIDVRVLQTEQAVKEYNALVAQGVRVGGVFHSTC |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage (see Stability and Storage for more details). If a different concentration is needed for your purposes please adjust the reconstitution volume as required (please note: the ion concentration of the final solution will vary according to the volume used). Note: Centrifuge vial before opening. When reconstituting, gently pipet and wash down the sides of the vial to ensure full recovery of the protein into solution. |
Gene Name | AAMDC adipogenesis associated Mth938 domain containing [ Homo sapiens (human) ] |
Official Symbol | AAMDC |
Synonyms | CK067; PTD015; C11orf67 |
Gene ID | 28971 |
mRNA Refseq | NM_001316957.3 |
Protein Refseq | NP_001303886.1 |
UniProt ID | Q9H7C9 |
◆ Recombinant Proteins | ||
AAMDC-1317H | Recombinant Human AAMDC | +Inquiry |
AAMDC-643H | Recombinant Human adipogenesis associated, Mth938 domain containing, His-tagged | +Inquiry |
AAMDC-1847HF | Recombinant Full Length Human AAMDC Protein, GST-tagged | +Inquiry |
AAMDC-1283H | Recombinant Human AAMDC Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
AAMDC-243H | Recombinant Human AAMDC Protein, MYC/DDK-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All AAMDC Products
Required fields are marked with *
My Review for All AAMDC Products
Required fields are marked with *
0
Inquiry Basket