Recombinant Human AASDHPPT Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | AASDHPPT-1479H |
Product Overview : | AASDHPPT MS Standard C13 and N15-labeled recombinant protein (NP_056238) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | The protein encoded by this gene is similar to Saccharomyces cerevisiae LYS5, which is required for the activation of the alpha-aminoadipate dehydrogenase in the biosynthetic pathway of lysine. Yeast alpha-aminoadipate dehydrogenase converts alpha-biosynthetic-aminoadipate semialdehyde to alpha-aminoadipate. It has been suggested that defects in the human gene result in pipecolic acidemia. |
Molecular Mass : | 35.8 kDa |
AA Sequence : | MVFPAKRFCLVPSMEGVRWAFSCGTWLPSRAEWLLAVRSIQPEEKERIGQFVFARDAKAAMAGRLMIRKLVAEKLNIPWNHIRLQRTAKGKPVLAKDSSNPYPNFNFNISHQGDYAVLAAEPELQVGIDIMKTSFPGRGSIPEFFHIMKRKFTNKEWETIRSFKDEWTQLDMFYRNWALKESFIKAIGVGLGFELQRLEFDLSPLNLDIGQVYKETRLFLDGEEEKEWAFEESKIDEHHFVAVALRKPDGSRHQDVPSQDDSKPTQRQFTILNFNDLMSSAVPMTPEDPSFWDCFCFTEEIPIRNGTKSTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | AASDHPPT aminoadipate-semialdehyde dehydrogenase-phosphopantetheinyl transferase [ Homo sapiens (human) ] |
Official Symbol | AASDHPPT |
Synonyms | AASDHPPT; aminoadipate-semialdehyde dehydrogenase-phosphopantetheinyl transferase; L-aminoadipate-semialdehyde dehydrogenase-phosphopantetheinyl transferase; AASD PPT; CGI 80; LYS5; LYS5 ortholog; 4-phosphopantetheinyl transferase; alpha-aminoadipic semialdehyde dehydrogenase-phosphopantetheinyl transferase; LYS2; CGI-80; AASD-PPT; |
Gene ID | 60496 |
mRNA Refseq | NM_015423 |
Protein Refseq | NP_056238 |
MIM | 607756 |
UniProt ID | Q9NRN7 |
◆ Recombinant Proteins | ||
AASDHPPT-4R | Recombinant Rhesus Macaque AASDHPPT Protein, His (Fc)-Avi-tagged | +Inquiry |
AASDHPPT-5354C | Recombinant Chicken AASDHPPT | +Inquiry |
Aasdhppt-1458M | Recombinant Mouse Aasdhppt Protein, Myc/DDK-tagged | +Inquiry |
AASDHPPT-025H | Recombinant Human AASDHPPT Protein, GST-tagged | +Inquiry |
AASDHPPT-389R | Recombinant Rat AASDHPPT Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
AASDHPPT-2HCL | Recombinant Human AASDHPPT cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All AASDHPPT Products
Required fields are marked with *
My Review for All AASDHPPT Products
Required fields are marked with *