Recombinant Human ABCA1 protein(1171-1280 aa), C-His-tagged

• Cat.No.: ABCA1-2493H
• Product Overview: Recombinant Human ABCA1 protein(O95477)(1171-1280 aa), fused with C-terminal His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 1171-1280 aa
• Form: 0.15 M Phosphate buffered saline
• Storage: Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
  Up to 12 months when aliquoted and stored at -20 to -80°C.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
• AA Sequence: HESDTLTIDVSAISNLIRKHVSEARLVEDIGHELTYVLPYEAAKEGAFVELFHEIDDRLSDLGISSYGISETTLEEIFLKVAEESGVDAETSDGTLPARRNRRAFGDKQS

Gene Information

• Gene Name: ABCA1 ATP-binding cassette, sub-family A (ABC1), member 1 [ Homo sapiens ]
• Official Symbol: ABCA1
• Synonyms: ABCA1; ATP-binding cassette, sub-family A (ABC1), member 1; ABC1, HDLDT1; ATP-binding cassette sub-family A member 1; Tangier disease; TGD; membrane-bound; ATP-binding cassette transporter 1; ATP-binding cassette transporter A1; cholesterol efflux regulatory protein; ABC1; CERP; ABC-1; HDLDT1
• Gene ID: 19
• mRNA Refseq: NM_005502
• Protein Refseq: NP_005493
• UniProt ID: O95477