Recombinant Human ABCA1 protein(1171-1280 aa), C-His-tagged
Cat.No. : | ABCA1-2493H |
Product Overview : | Recombinant Human ABCA1 protein(O95477)(1171-1280 aa), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1171-1280 aa |
Form : | 0.15 M Phosphate buffered saline |
Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
AA Sequence : | HESDTLTIDVSAISNLIRKHVSEARLVEDIGHELTYVLPYEAAKEGAFVELFHEIDDRLSDLGISSYGISETTLEEIFLKVAEESGVDAETSDGTLPARRNRRAFGDKQS |
Gene Name | ABCA1 ATP-binding cassette, sub-family A (ABC1), member 1 [ Homo sapiens ] |
Official Symbol | ABCA1 |
Synonyms | ABCA1; ATP-binding cassette, sub-family A (ABC1), member 1; ABC1, HDLDT1; ATP-binding cassette sub-family A member 1; Tangier disease; TGD; membrane-bound; ATP-binding cassette transporter 1; ATP-binding cassette transporter A1; cholesterol efflux regulatory protein; ABC1; CERP; ABC-1; HDLDT1; |
Gene ID | 19 |
mRNA Refseq | NM_005502 |
Protein Refseq | NP_005493 |
UniProt ID | O95477 |
◆ Recombinant Proteins | ||
ABCA1-2398H | Recombinant Human ABCA1 Protein, His (Fc)-Avi-tagged | +Inquiry |
ABHD10-9232H | Recombinant Human ABHD10 protein, His-tagged | +Inquiry |
ABCA1-5721C | Recombinant Chicken ABCA1 | +Inquiry |
ABCA1-0185H | Recombinant Human ABCA1 Protein (Ser45-Glu271), N-His-tagged | +Inquiry |
ABCA1-2493H | Recombinant Human ABCA1 protein(1171-1280 aa), C-His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ABCA1 Products
Required fields are marked with *
My Review for All ABCA1 Products
Required fields are marked with *
0
Inquiry Basket