Recombinant Human ABCA3 protein, His-tagged

Cat.No. : ABCA3-7453H
Product Overview : Recombinant Human ABCA3 protein(1606-1704 aa), fused with N-terminal His tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 1606-1704 aa
Tag : N-His
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
Purity : 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage.
AA Sequence : GSGYSLRAKVQSEGQQEALEEFKAFVDLTFPGSVLEDEHQGMVHYHLPGRDLSWAKVFGILEKAKEKYGVDDYSVSQISLEQVFLSFAHLQPPTAEEGR
Gene Name ABCA3 ATP-binding cassette, sub-family A (ABC1), member 3 [ Homo sapiens ]
Official Symbol ABCA3
Synonyms ABCA3; ATP-binding cassette, sub-family A (ABC1), member 3; ABC3; ATP-binding cassette sub-family A member 3; ABC C; EST111653; LBM180; ABC transporter 3; ABC-C transporter; ATP-binding cassette transporter 3; ABC-C; SMDP3; MGC72201; MGC166979;
Gene ID 21
mRNA Refseq NM_001089
Protein Refseq NP_001080
MIM 601615
UniProt ID Q99758

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ABCA3 Products

Required fields are marked with *

My Review for All ABCA3 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon