Recombinant Human ABCA3 protein, His-tagged
Cat.No. : | ABCA3-7453H |
Product Overview : | Recombinant Human ABCA3 protein(1606-1704 aa), fused with N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1606-1704 aa |
Tag : | N-His |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. |
AA Sequence : | GSGYSLRAKVQSEGQQEALEEFKAFVDLTFPGSVLEDEHQGMVHYHLPGRDLSWAKVFGILEKAKEKYGVDDYSVSQISLEQVFLSFAHLQPPTAEEGR |
Gene Name | ABCA3 ATP-binding cassette, sub-family A (ABC1), member 3 [ Homo sapiens ] |
Official Symbol | ABCA3 |
Synonyms | ABCA3; ATP-binding cassette, sub-family A (ABC1), member 3; ABC3; ATP-binding cassette sub-family A member 3; ABC C; EST111653; LBM180; ABC transporter 3; ABC-C transporter; ATP-binding cassette transporter 3; ABC-C; SMDP3; MGC72201; MGC166979; |
Gene ID | 21 |
mRNA Refseq | NM_001089 |
Protein Refseq | NP_001080 |
MIM | 601615 |
UniProt ID | Q99758 |
◆ Recombinant Proteins | ||
ABCA3-181M | Recombinant Mouse ABCA3 Protein, His (Fc)-Avi-tagged | +Inquiry |
ABCA3-2399H | Recombinant Human ABCA3 Protein, His (Fc)-Avi-tagged | +Inquiry |
ABCA3-1079M | Recombinant Mouse ABCA3 Protein | +Inquiry |
ABCA3-0508H | Recombinant Human ABCA3 Protein (Asp1358-Phe1635), N-His-tagged | +Inquiry |
ABCA3-1861H | Recombinant Human ABCA3 protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ABCA3-2HCL | Recombinant Human ABCA3 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ABCA3 Products
Required fields are marked with *
My Review for All ABCA3 Products
Required fields are marked with *
0
Inquiry Basket